Varför skall vi ha en uppdelad skola?

Finns det någonting som visar, att vårt lands utbildning blir bättre med en uppdelning av skolan? Det som framförts som avgörande delar är - valfriheten? För föräldrar har detta blivit en ”symbol” för att kunna välja (även om det blir sämre!). Den gemensamma skolan betraktas generellt som ”sämre”, även om detta inte är förhållandet - bättre utbildning? På vilket sätt, måste man fråga sig? Det finns ingenting som visat sig vara bättre i den uppdelade, fria skolan. Det framförs att man bä...

» Läs hela inlägget

Postat av: C G Carlsson - 20 januari 19:00, 2012

Ämnen: usapolitikprivatiseringsverigeutbildningskolanfriskolorsvtsocialdemokratinlärarnas riksförbundriskkapitalbolaglärarfacketfriskolebolaggpskatteparadissegregeringpysslingenvalfrihetenmetta fjelknerbaggiumfriskolekoncerneracademediasr ekotuppdelningenden gemensamma skolanden fria skolanatheneskolanguernsey
Senaste blogginlägg
Ducka eller ta ansvar för en ny färdriktning
"Vi är inte ett ensamt land uppe i norr som har stått emot förändringar ut..."
Roger Jönsson - 2 timmar sedan
Kalla inte Stefan Löfven svikare!
"Det handlar om 31 procent i riksdagsvalet, vilket blev det resultat som v..."
Björn Andersson - 3 timmar sedan
Nu måste vi får en regering som vill utveckla hela Sverige
"Sverige börjar i söder och slutar i norr Norrland är den nordligaste oc..."
Tord Oscarsson - 5 timmar sedan
Svår uppgift väntar för Moderaternai Det finns nu inte någon stark kandidat att efterträda Fredrik Reinfeldt
" Svår uppgift väntar för Moderaterna Publice..."
Tord Oscarsson - 6 timmar sedan
Sundsvallsbron öppnar 18 december
"Sundsvallsbron öppnar 18 december ..."
Tord Oscarsson - 15 timmar sedan
S enda chans till långsiktig överlevnad är att våga återskapa en tydlig skillnad mellan vänster och höger
"Daniel Suhonen skrev i Sydsvenskan inför valet den 14 september en fantas..."
Bo Widegren - 17 timmar sedan
Var fanns vänstervinden?.
"På DN-debatt skriver idag Enna Gerin och Daniel Suhonen från Katalys om a..."
Jan Andersson - 20 timmar sedan
En dag i en folkrörelse
"Idag hade jag den stora förmånen att besök Närlundadagen här i Helsingbor..."
Olas tankar - 20 timmar sedan
Det svenska missnöjet
"Många av dem som röstat på Sverigedemokraterna är varken rasister eller f..."
Mario Matteoni - 21 timmar sedan
Sverige står inför stora utmaningar - dags att sluta tjafsa
"Det hela över. Åtta år med alliansen vid makten är slut. Väljarna har sag..."
Roger Jönsson - 23 timmar sedan
Melodikrysset nummer 38 2014
"Vi ska ha stort familjekalas senare i dag – se nedan under nästa rubrik –..."
Enn Kokk - 1 dagar sedan
Beska sanningar om S-strategin
""S tappar när de fiskar i mitten." Den beska sanningen levereras av inge..."
Bengt Silfverstrand - 1 dagar sedan
Vänstervinden som ingen märkte
"I en debattartikeli dagens DN skriver Daniel Suhonen och Enna Gerin: ..."
Mario Matteoni - 1 dagar sedan
Socialdemokrater, ryck upp er!
"Idag lever vi ett samhälle som högern har skapat. Under åtta års tid så h..."
Björn Andersson - 1 dagar sedan
Ska Centerpartiet gå Maud Olofssons eller Olof Johanssons väg?
"Alla är nu medvetna om att vårt land står inför ett mera kritiskt vägval ..."
Bror Perjus - 1 dagar sedan
Förlust – då vänder Reinfeldt ryggen till
" Startsidan / Nyheter / Valåret 2014 2014-09-2..."
Tord Oscarsson - 1 dagar sedan
Se 2014 års Valresultat
" Valet 2014 Se 2014 års v..."
Tord Oscarsson - 1 dagar sedan
Får solidariteten stryka på foten?
""Som socialdemokrat står jag upp för människors lika värde. Det innebär f..."
Bengt Silfverstrand - 2 dagar sedan
Om val av riksdagens talman
"Susanne Eberstein Den 29 september kommer den nyvalda Riksdagen att gå ..."
Göran Johansson - 2 dagar sedan
Gör gärna upp med C o Fp, men var inte rädd för nyval! Vi är beredda att knacka dörr igen, från Smygehuk till Riksgränsen.
"Stefan Löfven, förhandla kraftfullt utifrån styrka och självkänsla. Du ha..."
Bror Perjus - 2 dagar sedan
Vem leder borgerligheten i ett nyval?
"Vissa borgerliga debattörer och politiker skramlar högljutt med vapnen nä..."
Peter Johansson - 2 dagar sedan
Det här med att bjuda till....
"     Just nu pågår samtal mellan Stefan Löfven och de olika borger..."
Monica Green - 2 dagar sedan
Stefan Löfven är långt ifrån naiv.
"I en enskild tidning kan finnas många olika uppfattningar. Så är det i la..."
Jan Andersson - 2 dagar sedan
Stefan Löfven vill ta ansvar
"Regeringsbildare Igår eftermiddag blev det till slut klart att talmanne..."
Göran Johansson - 2 dagar sedan
Ska vi ha betyg i förskolan?
"Det finns en oro över att det ska bli betyg i 4an och till och med i lägr..."
Björn Andersson - 3 dagar sedan
Kryssen är färdigräknade - tack för stödet
"Tack alla som röstat på socialdemokraterna i Skaraborg och tack för alla ..."
Monica Green - 3 dagar sedan
"Tre närstående av olika generationer – Birgitta , vår dotter Kerstin och ..."
Enn Kokk - 3 dagar sedan
Löfven får bilda ny regeringn -Nu vill se S-ledaren se blocköverskridande överenskommelser.
"Löfven får bilda ny regering S-ledaren höll pressträff med talmannen i r..."
Tord Oscarsson - 3 dagar sedan
Främlingsfientlighet är illa nog
"Varför inte ta kampen mot invandrarfientligheten i stället för mot etiket..."
Mario Matteoni - 3 dagar sedan
Kaoset på arbetsmarknaden borde gjorts till en huvudfråga i valrörelsen?
"Ett av två avgörande strategiska misstag i valrörelsen var, som jag skriv..."
Bror Perjus - 3 dagar sedan
Försvarar Centern budgetens integritet?
"Un der gårdagen fortsatte media diskussionerna om huruvida en regering le..."
Göran Johansson - 3 dagar sedan
Den sviktande välfärdsstaten är problemet
"En politiserande talman, dåliga förlorare på borgarsidan och mediala orgi..."
Bengt Silfverstrand - 3 dagar sedan
349 till ansvar dömda riksdagsledamöter
"Fyra dagar efter valet cirkulerar den politiska debatten kring den komman..."
Peter Johansson - 3 dagar sedan
I väntans tider
"Foto: Wikipedia Valet är över. Spelplanen för dom nästkommande fyra åren..."
Olas tankar - 3 dagar sedan
Talman Per Westerberg agerar tyvärr partipolitiskt.
"Talmannen har en central funktion när en ny regering ska utses. Uppdraget..."
Jan Andersson - 3 dagar sedan
Ska den nya regeringen använda sig av alliansens budgetförslag?
"Daniel Tarschys Daniel Tarschys, tidigare riksdagsledamot för Folkparti..."
Göran Johansson - 3 dagar sedan
Valresultat 2014
" ..."
Tord Oscarsson - 3 dagar sedan
S,V,Mp får 51,9 och Alliansen 32,6 iHärnösand
" Visa bildtext G..."
Tord Oscarsson - 3 dagar sedan
Demokratin i sjönöd - men käbbel bland de sju och SD vinner
"Det är egentligen en självklarhet - säger jag NEJ till mina ungar utan en..."
Jan Paimo - 3 dagar sedan
En obehagling sanning om Sverigedemokraterna!
"Det var inte endast Sverigedemokraterna som gick fram i valet 2014. Även ..."
Björn Andersson - 4 dagar sedan
Kjelle och Bettan i Indien
"Jag har tidigare med uppskattning – se ovan under Kulturspegeln, Barnkult..."
Enn Kokk - 4 dagar sedan
Vill inte väljare att det ska byggas bostäder?
"Det här blogginlägget skulle egentligen handla om att väljarna är mer pro..."
Joakim Jonsson - 4 dagar sedan
Maud Olofsson har spelat Monopol med Nuon
"Hör jag på radion att Totalförsvarets forskningsinstitut, FOIs generaldir..."
Monica Green - 4 dagar sedan
Valet gav inga lättolkade lösningar och lämnade massa frågor obesvarade!
"Ideologin omöjlig för att lösa ett läge utan klar majoritet? Bör väljarn..."
Bo Widegren - 4 dagar sedan
Nej, det kan man inte!
"Petter Lidbecks (text) och Lisen Adbåges (bild) " Kan man…? " (En bok för..."
Enn Kokk - 4 dagar sedan
Mätningarnas mätning 13 september 2014 S,V,Mp 170 ...
"Mätningarnas mätning 13 september 2014 S,V,Mp 170... ..."
Tord Oscarsson - 4 dagar sedan
IVO har inte fått alla handlingar, trots att de sista skickades 12 september- slutdatum är idag
"Onsdag den 17 september Det blev som jag trodde med de rekommende..."
Eva-Britt Dahlström - 4 dagar sedan
En liten stund med pannkakor eller med körsbärspaj
"Anna-Clara Tidholm är en mycket skicklig skapare av böcker för små barn. ..."
Enn Kokk - 4 dagar sedan
Natomedlemskap - till allt utom namnet
"Den avtalstext som den avgående regeringen lät offentliggöra igår är ska..."
Stefan Lindgren - 4 dagar sedan
Digital kommunikation lika viktig som fysiska vägar
"På IT-branschens terminsstart fick vi en diger genomgång av operatörernas..."
Monica Green - 4 dagar sedan
Tid för pragmatiker, inte fundamentalister.
"I min förra blogg kritiserade jag Maud Olofsson. Det är svårt att idag tr..."
Jan Andersson - 4 dagar sedan
Plötsligt avgick Fredrik Reinfeldt och avsatte hela sin regering. Helt i onödan!
"De tog aldrig politiken på allvar och därmed heller inte demokratin. Därf..."
Bror Perjus - 4 dagar sedan
Dags för politiskt ansvar. Alternativet förskräcker!
"Det är många som formulerar mycket om vad som nu behöver ske i Sverige. R..."
Lars G Linder - 4 dagar sedan
Kommer M att avstå röster från dumma lantisar?
" Anna Kinberg Batra, mest känd för sitt förakt mot "Lantisar", ska enlig..."
Peter Johansson - 4 dagar sedan
Hur samarbetsvilligt är Alliansen?
"Gardell tar det med ro Ett par av de rikstäckande tidningarna har sonde..."
Göran Johansson - 4 dagar sedan
Riksdag Landsting Kommun År 2014 i Västenorrlnds Län
"Redigerat av Tord Oscarsson Se 2014 års valresultat Upp..."
Tord Oscarsson - 4 dagar sedan
Migrationsexpeditionsminister kan väl inte avsättas hur korkat han än pratar?
"Tobias Billströms facebooksida 2014-09-15: ”En ny dag. Annorlunda. På väg..."
Bo Widegren - 4 dagar sedan
Tankar kring valutgången och om det som ska komma
"Jag är givetvis glad över att regeringen har välts över ända, framför all..."
Enn Kokk - 5 dagar sedan
Tack till S-kvinnor i Skövde
"   Stort tack för allt arbete ni utfört under valrörelsen. S-kvinnor i..."
Monica Green - 5 dagar sedan
Det pågår en eftervalsdebatt på arbetspatserna!
"Det pågår en eftervalsdebatt. Det handlar om en ekonomi och debatt om inv..."
Björn Andersson - 5 dagar sedan
Mätningarnas mätning 13 september 2014 S,V,Mp 170 mandat Alliansen 143 Sd 36
"Redigerat av Tord Oscarsson ..."
Tord Oscarsson - 5 dagar sedan
Militanta Maud är numera tillgänglig för media.
"Maud Olofsson var under en tid inte tillgänglig för varken KU eller för m..."
Jan Andersson - 5 dagar sedan
Norrland måste också få chans att utvecklas. Den nya regeringen är inriktad på det.
"Jag har noga följt 2014 års val. Det slutade med rödgrön seger på många n..."
Tord Oscarsson - 5 dagar sedan
TV4/Novus Väljarbarometer 13 september 2014: De rödgröna leder
"TV4/Novus Väljarbarometer 13 september 2014: Blockskillnad 5.3 % 13 ..."
Tord Oscarsson - 5 dagar sedan
DN/Ipsos: Rödgröna partierna leder klart
" DN/Ipsos: Rödgröna partierna leder klart Redigerat av Tord Oscar..."
Tord Oscarsson - 5 dagar sedan
Reinfeldt meddelar sin avgång i känslosamt tal
" Reinfeldt meddelar sin avgång i känslosamt tal ..."
Tord Oscarsson - 5 dagar sedan
Finlands Gröna lämnar regeringen på torsdag
"Gröna förbundet ( Vihreä Liitto ) lämnar med största sannolikhet regering..."
Enn Kokk - 5 dagar sedan
Vill borgarna verkligen ha nyval?
"Valrörelsen är över oss och resultatet är ovant för Sverige. Vi har levt ..."
Peter Johansson - 5 dagar sedan
Valets vedermödor och vänsterskräck
"Svenska folket har röstat för en förändring. Det var Stefan Löfvens entyd..."
Bengt Silfverstrand - 5 dagar sedan
Socialdemokratiet på hyggligt hög nivå i ny dansk mätning
"I Voxmeters senaste mätning ligger Socialdemokratiet inte bara tvåa utan ..."
Enn Kokk - 5 dagar sedan
Sverigedemokraterna utestänger media
"Under valdagen blev det bekant att Sverigedemokraterna (SD) valt att utes..."
Göran Johansson - 5 dagar sedan
Kammarorkestern med Ellen Nisbeth som solist på viola
"Höstsäsongens första konsert med Uppsala kammarorkester , som vanligt und..."
Enn Kokk - 5 dagar sedan
Kammarorkestern med Ellen Nisbeth som solist på viola
"Höstsäsongens första konsert med Uppsala kammarorkester , som vanligt und..."
Enn Kokk - 5 dagar sedan
Politiken kommer att ligga i mittfåran.
"Det var inte alls överraskande att Stefan Löfven inte vill ha med vänster..."
Jan Andersson - 5 dagar sedan
Allt tyder på maktskifte
" Allt tyder på maktskifte Publicerad 2014-09-12 19:30 ..."
Tord Oscarsson - 5 dagar sedan
Ny opinionsmätning: Ökat gap mellan blocken
" ..."
Tord Oscarsson - 5 dagar sedan
Martin Mobergs betraktelser har flyttat fr o m idag...
"Det har under de senaste dryga sex åren blivit dagligen återkommande blog..."
Martin Moberg - 5 dagar sedan
S,V,Mp 41,7 Alliansen 39,3 Sd 12,9
"S 30,2 V 5,7 Mp 5,8 = 41,7 M 23,2 Fp 5,4 C 61 Kd 4,6 = 39,3 Sd 12,9 T..."
Tord Oscarsson - 5 dagar sedan
Den nya bilden av Sverige och väljarna
" Den nya bilden av Sverige och väljarna ..."
Tord Oscarsson - 5 dagar sedan
Alla valdistrikt (5837) i Sverige är färdigräknade. 010203040010203040
" Visar resultat för land: Sverige ..."
Tord Oscarsson - 5 dagar sedan
Är det bara jag som tycker det är lätt!
"Idag kommer Stefan Löfven att få talmannens uppdrag att bilda regering. D..."
Joakim Jonsson - 5 dagar sedan
"Besviken Stefan Löfven har startat diskussionerna om att bilda en reger..."
Göran Johansson - 5 dagar sedan
Här rasar moderaterna mest På den skånska slätten tappade Fredrik Reinfeldt 14 %
"Här rasar moderaterna mest Publicerad 2014-09-15 17:10 ..."
Tord Oscarsson - 5 dagar sedan
Härnösand Fortsatt rödgrönt samarbete
"Fortsatt rödgrönt samarbete ..."
Tord Oscarsson - 5 dagar sedan
Moderaterna ett parti i kris - När topptrion Reinfeldt, Bildt och Borg försvinner uppstår ett vakuum som måste fyllas.
"Moderaterna ett parti i kris I ett slag försvinner Moderaternas topptr..."
Tord Oscarsson - 5 dagar sedan
Nu kommer svekdebatten från höger och vänster!
"Idag går Vänsterpartiets Jonas Sjöstedt och gråter ut i Agenda !Socialdem..."
Björn Andersson - 6 dagar sedan
Grattis S i Härnösand!
"Grattis S i Härnösand till ett nytt mandat i kommunfullmäktige och till e..."
Sig-Britt Ahl - 6 dagar sedan
Har någon missat att se Die Welle?
"I så fall kan jag verkligen rekommendera den. Den borde vara självskriven..."
Mats Andersson - 6 dagar sedan
#val2014 - politik för jämlikhet bra för sjukvården...
"(landstingsvalet i Blekinge med fortsatt rödgrön majoritet) I valsammanh..."
Martin Moberg - 6 dagar sedan
Löfven: ”Det ska vara flera partier i regeringen”
"Löfven: ”Det ska vara flera partier i regeringen” Löfven stänger inga ..."
Tord Oscarsson - 6 dagar sedan
Den gråtande sverigedemokraten
"Hon hade kanske varit en vända på krogen, och klockan var sent. Vi skulle..."
Sjölander - 6 dagar sedan
Partiledningens två allvarliga och avgörande misstag i valrörelsen!
"Den socialdemokratiska partiledningen gjorde två allvarliga strategiska m..."
Bror Perjus - 6 dagar sedan
#val2014 - den sociala infrastrukturens betydelse...
"(preliminärt valresultat kommunalvalet Ronneby 14/9 -14) Jag var under g..."
Martin Moberg - 6 dagar sedan
De lämnar allianskeppet
"    Under valnatten meddelade Fredrik Reinfeldt sin avgång som par..."
Monica Green - 6 dagar sedan
#val2014 - det vart en delvis seger....
"Samlar tankarna efter gårdagens val , som på många sätt lämnar en hel del..."
Martin Moberg - 6 dagar sedan
SD skördade Reinfeldts draksådd
"Med draksådd menas utspridande av fördärvbringande åsikter eller läror, e..."
Peter Johansson - 6 dagar sedan
När morgonen gick sönder.
"- Du ser, du ser, säger han belåtet till mig. Det här är vad som händer n..."
Calle Fridén - 6 dagar sedan
Stor glädje med lite smolk i bägaren.
"Stefan Löfven kommer att få uppdraget att bilda en ny regering. Det är sl..."
Jan Andersson - 6 dagar sedan
M kastade skit på Malmö och fick ett rungande svar – Malmöstyle #val2014
"Jag kommer att skriva ett antal valanalysposter de kommande veckorna. Med..."
Peter Johansson - 6 dagar sedan
Lövfen är rätt man
"Valresultatet kommer att så småningom påverka och förändra samtliga parti..."
Mario Matteoni - 6 dagar sedan
Stefan Löfven blir statsminister
"Stefan Löfven När jag skriver detta inlägg tyder allt på att alliansens..."
Göran Johansson - 6 dagar sedan
Blockpolitiken är död, länge leve demokratin och politiken
"När man surfar omkring på olika bloggar och läser tidningar är det flera ..."
Joakim Jonsson - 6 dagar sedan
Reinfeldt avgår som statsminister och moderatledare. Löfven är redo att bilda ny regering och sträcker ut handen till alla partier utom SD
"Efter valfiaskot kom bomben. Klockan 23.18 meddelade Fredrik Reinfeldt at..."
Tord Oscarsson - 6 dagar sedan
Socialdemokraterna vann valet!!
"Socialdemokraterna vann valet 2014. Det visar vid skrivandes stund. Fredr..."
Björn Andersson - 6 dagar sedan
Min favoritregering vann!
"För över 1,5 år sedan skrev jag på den här bloggen att den bästa regering..."
Joakim Jonsson - 7 dagar sedan
2014 års val i Härnösand. Nuvarande kommunledning får 58.5 %
"M 12,0 C 17,1 Fp 2,4 Kd 2,4= 33.9 S 43,5 V 7,5 Mp 7.5 = 58,5 Sd 6,9 Re..."
Tord Oscarsson - 7 dagar sedan
Följ 2014 års valresultat S,V.;Mp 44,0 % Alliansen 38,4
"2014 Följ 2014 års valresultat Uppdaterad i dag 20:5..."
Tord Oscarsson - 7 dagar sedan
Alliansen 39,7 Rödgröna 44,8
Tord Oscarsson - 7 dagar sedan
Välslickade Måns, Bill, Bull och stygga Annie
"Elaka Måns sa: Stygga Annie gjorde precis som vi sa åt henne och bröt mot..."
Bo Widegren - 7 dagar sedan
Förnedringsteve - grejen för TV4
"Meddelande Eftersom vi är ett privat bolag så har vi inte så fasta regle..."
Bo Widegren - 7 dagar sedan
"Klockan har nu nyss passerat 19.00 på kvällen, valdagen, den 14 september..."
Bernt Ortner - 7 dagar sedan
"Tack alla valarbetare i Skövde, Skaraborg och Sverige som kämpat ända in ..."
Monica Green - 7 dagar sedan
Några timmar före resultatet: Lugn Fi kommer in i Riksdagen!
"Fi måste ta sig över spärren! Det är bara några timmar kvar och dags för..."
Bo Widegren - 7 dagar sedan
Som alltid har jag röstat på Socialdemokraterna
"Jag blev i mycket unga år socialdemokrat, och när jag fick rösträtt, röst..."
Enn Kokk - 7 dagar sedan
Allt tyder på maktskifte. S,V,Mp 46,4 Alliansewn 39,5 Valets stora förlorare ser ut att bli Moderaterna.
" Allt tyder på maktskifte Publicerad 2014-09-12 19:30 ..."
Tord Oscarsson - 7 dagar sedan
Valet 2014, en sammanfattning del 2.
"Idag har jag stått två timmar utanför Myrsjöskolan i Orminge. Det som upp..."
Björn Andersson - 7 dagar sedan
Arboga öl och valet
"Jag har redan utfört min medborgerliga plikt genom att den här gången för..."
Bengt Silfverstrand - 7 dagar sedan
I dag är det demokratins högtidsdag
"Nu har jag arbetat färdigt i valrörelsen. Givit järnet i 4 veckor, föruto..."
Britta Sethson - 7 dagar sedan
#val2014: Val och "val", dags ta ställning
"(apropå detta med valfrihet, så här på valdagen - illustr: Robert Nyberg)..."
Martin Moberg - 7 dagar sedan
Valet 2014, en sammanfattning del 1.
" Igår ägnade hela dagen åt valrörelsen. Jag har stått i Orminge ..."
Björn Andersson - 7 dagar sedan
Den längsta dagen.
"När jag var barn talades det om långfredagen som årets längsta dag efters..."
Jan Andersson - 7 dagar sedan
Därför ska du rösta i valet idag!
"Sverige är ett demokratiskt land där vi har möjligheten att påverka och f..."
Björn Andersson - 7 dagar sedan
Riksadagsvalet 13 september 2014 S,V,Mp166 mandast . Alliansen 146. Sd 47
"R iksdagsvalet Publicerad 13 september 2014 Uppdaterad 13 sept..."
Tord Oscarsson - 7 dagar sedan
SONU-genomsnitt* 13 sep S,V,Mp 175 mandat Alliansen 135 SD 39
" SONU-genomsnitt* 13 sep..."
Tord Oscarsson - 7 dagar sedan
Alliansen 40,1 SVMP 51,1 S,V,Mp 195 mandat Alliansen 112 Sd 42
"T Både Centerpartiet och Kristdemokraterna är åter under 4 procentspärre..."
Tord Oscarsson - 7 dagar sedan
Det kan inte uttryckas på ett bättre sätt
"Kommentarer överflödiga. Rösta rätt… Mats Och var stolt över Sv..."
Mats Andersson - 8 dagar sedan
Starkt jobbat SSU i Nässjö
"Ännu en natt med öppen valstuga. Det ser ut som om vi är det enda parti..."
Mats Andersson - 8 dagar sedan
Nytt ledarskap för Skåne
"Snart går skåningarna till val för att bestämma vem som ska leda den skån..."
Sjukvårdsvalet - 8 dagar sedan
Vi vill satsa på Ystad lasarett
"Ystad lasarett har en viktig roll att spela för de boende i Ystad med omn..."
Sjukvårdsvalet - 8 dagar sedan
Man ska ju inte bli sjuk och inte arbetslös
" Man går kanske inte och tänker på vad som händer i Sverige. Vad skatte..."
Gällivareortens Socialdemokratiska Arbetarekommun - 8 dagar sedan
Ett dygn kvar – På Söndag byter vi!
"Vilken valrörelse! Jag tror jag genomfört mer än 1500 personliga samtal m..."
Chatarina Holmberg - 8 dagar sedan
Mitt sista blogginlägg
"I över fyra år har jag skrivit inlägg på den här bloggen i syfte att förs..."
Joakim Jonsson - 8 dagar sedan
När aktivismen åkte till sommarstugan
"Egentligen gillar jag valrörelser. Ja, inte fördumningen eller förenkling..."
Calle Fridén - 8 dagar sedan
Arbetsmiljön för kvinnor blir sämre och sämre
"Det har skett en stor förändring bara sedan 2011. Jag tycker att arbetsli..."
Lennart Holmlund - 8 dagar sedan
S hack i häl på Venstre i ny dansk mätning. Dansk Folkeparti nere på tredje plats
"De danska opinionsundersökningarna fortsätter att ge skiftande resultat. ..."
Enn Kokk - 8 dagar sedan
Arbeiderpartiet större än Høyre i Oslo
"Den opinionsmätning Sentio har gjort för Klassekampen , i dag för övrigt ..."
Enn Kokk - 8 dagar sedan
Att inte ha råd med en pulka till sin dotter...
"(#utförsäkrad i Reinfeldts Sverige , inte enstaka fall...) För en stund ..."
Martin Moberg - 8 dagar sedan
Aftonbladet träffade Löfven på tåget till Göteborg. Han delade kupé med vallokomotivet Margot Wallström,
"Aftonbladet träffade Löfven på tåget till Göteborg. Han delade kupé med..."
Tord Oscarsson - 8 dagar sedan
Du avgör Sveriges framtid
"Ett dygn kvar tills din röst räknas Imorgon är valdagen här och din röst ..."
Monica Green - 8 dagar sedan
Skövde Stadslopp
"  En härlig dag med septembersol och mycket folk i farten. Rekordmång..."
Monica Green - 8 dagar sedan
#val2014: dags för en kopp stark kaffe med extra bönor
"Igår kväll var det dags för SVT:s traditionella slutdebatt mellan riksdag..."
Martin Moberg - 8 dagar sedan
Valfläsk och vankelmod
"En märklig valrörelse lider mot sitt slut. Den ena debatten avlöser den a..."
Bengt Silfverstrand - 8 dagar sedan
Melodikrysset nummer 37 2014
"I dag, dagen före valet, aktade sig Anders Eldeman noga för att spela mus..."
Enn Kokk - 8 dagar sedan
Fredrik Reinfeldt sista debatt
"Ikväll är det statsministerduell mellan Stefan Löfven och Fredrik Reinfel..."
Joakim Jonsson - 8 dagar sedan
Fler lärare och mindre klasser
" Om Socialdemokraterna tar regeringsmakten efter söndagens val kommer vi ..."
Bloggande Socialdemokrater i Halland - 8 dagar sedan
Feministiskt initiativ, Fi, kan komma in och skapa en vänstermajoritet
"Enligt såväl DNs som SvDs opinionsmätningar idag är Sverigedemokraterna v..."
Bror Perjus - 8 dagar sedan
Kort mening
"SPRÅKRÖR i norska Miljøpartiet De Grønne : Aase Morsom. ..."
Enn Kokk - 8 dagar sedan
En ovanlig valrörelse.
"Valrörelsen närmar sig sitt slut. det ser ut som om det blir regeringsski..."
Jan Andersson - 8 dagar sedan
Har vi en vinnande Miljöpolitk, som ingen talar om!?
"Jag ser en vision. Det handlar om ett grönt Folkhem. I det gröna folkhemm..."
Björn Andersson - 8 dagar sedan
K-G: Allt talar för en rödgrön regering S,V Mp 187 mandat Alliansen 127 SD 35
" Skapa konto, gratis! ","createaccounturl":"https://id.expresse..."
Tord Oscarsson - 8 dagar sedan
Allt tyder på maktskifteI I DN/Ipsos slutmätning är skillnaden mellan blocken 6,8 procentenheter.
"S 170 mandat Alliansen 145 Sd 34 ..."
Tord Oscarsson - 8 dagar sedan
Demoskop S,V. Mp De rödgröna ett försprång på 5,7 %
"Kontakta Sveriges radio ..."
Tord Oscarsson - 8 dagar sedan
Om Joe Hill hos Uppsala pensionärsföreningars samarbetsråd
"UPS , Uppsala pensionärsföreningars samarbetsråd , bad mig, när jag för i..."
Enn Kokk - 9 dagar sedan
Tord Oscarsson Svar på fråga jag låg 15 månadet på fältjägar departementet i Östersund
"God morgon, Tord! Har du varit soldat? frågade mina döttrar Zoe och Sa..."
Tord Oscarsson - 9 dagar sedan
Expressen/Demoskops valprognos är Reinfeldt den stora förloraren - moderaterna landar på 20,9 procent.
" Statsvetarprofessor Leif Levin tror att Fredrik Reinfeldt avgår eft..."
Tord Oscarsson - 9 dagar sedan
Nina Eriksson
"”Hur orkar du egentligen?!” Det får jag ofta höra när jag måste ta..."
Gällivareortens Socialdemokratiska Arbetarekommun - 9 dagar sedan
Politiska prioriteringar och konsekvenserna därav...
"(det mullrar i folkdjupet två dagar före valet - illustr: Robert Nyberg) ..."
Martin Moberg - 9 dagar sedan
Så här blir slutdebatten ikväll!
"Dagens stora snackis i mediasverige och därmed runt om i landet är huruvi..."
Joakim Jonsson - 9 dagar sedan
Ovanligt tyst om en havererad förlossning!
" Under flera år så har de kunnat vi se i kvinnors underliv att de..."
Björn Andersson - 9 dagar sedan
Därför dags för prioritering av bra o säker arbetsmiljö...
"(Inte OK, tydlig ojämställd profil vad gäller konsekvenserna av den allt ..."
Martin Moberg - 9 dagar sedan
Åter igen ett klokt uttalande från vännen K-G Wanngård
"Fick just detta för ögonen. K-G Wanngård beskriver någonting i sak väld..."
Mats Andersson - 9 dagar sedan
Opinionsmätning: Fi kommer in i riksdagen
"Opinionsmätning: Fi kommer in i riksdagen Fi kommer in i riksd..."
Tord Oscarsson - 9 dagar sedan
Annie Lööf - stureplanstjejen med egna regler för demokratisk debatt
"Min stylist har sagt: bråka du är bäst som kränkt oskuld Annie Lööf till..."
Bo Widegren - 9 dagar sedan
Två politiska broilers som inte tycks veta att ett nej är ett nej.
"I gårdagens debatt liksom kvällens debatt är det två av partiledarna som ..."
Jan Andersson - 9 dagar sedan
På söndag avgör du – 54 timmar kvar
" Valet på söndag handlar om hur du vill att samhället ska vara. Ska vi..."
Bloggande Socialdemokrater i Halland - 9 dagar sedan
(S) lovar fler anställda på Hässleholms sjukhus och att vårdcentralen blir kvar i Ljungdala
"Hässleholms sjukhus har drabbats av de senaste årens nedskärningar och om..."
Sjukvårdsvalet - 9 dagar sedan
Att unyttja sig själv som kvinna är antifeminism. Men nu skyr Alliansen inga medel för att vända opinionen.
"Eländig debatt. Det var en eländig debatt i TV4 igår kväll. Mötet mellan ..."
Bror Perjus - 9 dagar sedan
Det pekar på Dig Löfven Fortfarande är det mest sannolika att S-ledaren Stefan Löfven får förtroendet att bilda regering efter valet.
"Lena Mellin MEJLA FLER KRÖNIKOR Det pekar på dig, Löfve..."
Tord Oscarsson - 9 dagar sedan
Om skendebatter och valets väsentligheter
"Efter att ha bevittnat gårdagens partiledardebatt i TV4 är jag egentligen..."
Bengt Silfverstrand - 9 dagar sedan
Stärk patientens rätt till fast vårdkontakt
"Många av de patienter som behöver insatser från flera olika delar av sjuk..."
Sjukvårdsvalet - 9 dagar sedan
Så blir vi av med välfärdsoligarkerna
"Att  det är skadligt att välfärden styrs av vinstintressen finns det en r..."
Peter Johansson - 9 dagar sedan
Vem var det egentligen som utövade härskarteknik?
"Tänk om Stefan Löfven i gårdagens debatt i TV4 hade gått över till Annie ..."
Jan Andersson - 9 dagar sedan
SONU GENOMSNITT 10 SEPTEMBER S,V,mp 167 mandat Alliansen 145 Sd 37
Tord Oscarsson - 9 dagar sedan
Alliansen störtdyker i opinionen bland unga väljare RÖDGRÖNA 48,6 ALLIANSEN 28 %
" Alliansen störtdyker i opinionen bland unga väljare ..."
Tord Oscarsson - 9 dagar sedan
Annie Lööf utförde härskarteknik och mobbning i TV4 igår!
"Igår var det debatt och Annie Lööf tog plötsligt upp en lunta papper. Det..."
Björn Andersson - 9 dagar sedan
De skiftande resultaten i danska opinionsundersökningar resultat av osäkerhet bland väljarna eller av skillnader i mätmetoder?
"De danska opinionsundersökningarna visar så ofta olika resultat, att man ..."
Enn Kokk - 9 dagar sedan
Nytt Sollentunarekord i dörrknackning
"Nu är det inte många timmar kvar inför valdagen och vi Socialdemokrater i..."
Joakim Jonsson - 10 dagar sedan
Det är fel att ha ett organiserat samarbete med Vänsterpartiet
"Vi har haft det i Umeå denna period och det är ingen höjdare och jag vill..."
Lennart Holmlund - 10 dagar sedan
Vilka prioriteringar gör TV4?
"TV4 har partiledardebatt. Första ämne är invandring och integration. Det ..."
Jan Andersson - 10 dagar sedan
Har man en gång fått in det…
"..så sitter det i ryggmärgen. Det syntes att Stefan Löfven har tränat en..."
Mats Andersson - 10 dagar sedan
"Stolt med inte nöjd"
"Jag fick idag en fråga från med medborgare: "Är ni nöjda med den sjukvård..."
Jan-Åke Simonsson - 10 dagar sedan
Valets viktigaste fråga, vilket samhälle vill vi ha?
"(ja, vilket samhälle vill vi ha? - illustr: Berglins) Torsdagskväll och ..."
Martin Moberg - 10 dagar sedan
- Idag får vi kämpa i ditt ställe - Anna Lindh in Memorian
" Mitt i EU valrörelsen 2003 togs du ifrån oss. Affischerna hängde..."
Björn Andersson - 10 dagar sedan
Fler jobb i Halland
" En av valets hetaste fråga handlar om hur vi ser till att fler människo..."
Bloggande Socialdemokrater i Halland - 10 dagar sedan
Utbildningsministern borde sätta sig på skolbänken efter valet.
"Sofia Arkelsten påstod tidigare att moderaternas föregångare , det gamla ..."
Jan Andersson - 10 dagar sedan
#4 Freddie talar fritt med Jens Sjöström
"Idag släpper vi det näst sista podcast programmet i serien ”Fre ddie tala..."
Freddie Lundqvist - 10 dagar sedan
Fokus: Sjukvården i Kristianstad
"Om Socialdemokraterna vinner valet i Region Skåne kommer man satsa på sju..."
Sjukvårdsvalet - 10 dagar sedan
11 september är ett datum fyllt av olycka
" 11 september 1973 störtade den chilenska militären den demokratiskt val..."
Peter Johansson - 10 dagar sedan
Ska sjuka sjukförsäkringen tillåtas förstöra för fler...?
"(i sin ordning sett från Reinfeldts perspektiv - illustr: Kjell Nilsson-M..."
Martin Moberg - 10 dagar sedan
Drop-in-mottagning för bröstcancer
"Väntetiderna från misstanke om cancer, till diagnos och därefter behandli..."
Sjukvårdsvalet - 10 dagar sedan
Idag hedrar vi Anna Lindh.
"Idag är det elva år sedan Anna Lindh mördades. Då var det bara några daga..."
Jan Andersson - 10 dagar sedan
Låt regionen köra ambulansen
"Ambulansföretaget Sirius Humanum satte för två år sedan ett olönsamt dott..."
Sjukvårdsvalet - 10 dagar sedan
(S)topp för fler ingrepp i den lokala sjukvården
"Sjukhuset är viktigt för de boende i Hässleholm och i dess närområde. Sär..."
Sjukvårdsvalet - 10 dagar sedan
Varje dag avslöjaqs något om Sverigedemokraterna
"Expressen gör ett bra jobboch avslöjar vilka personer Sverigedemokraterna..."
Lennart Holmlund - 10 dagar sedan
Dags för #tryggajobb, dags för ny politik o regering
"Det är idag tre dagar kvar till valet och valtemperaturen den höjs nu und..."
Martin Moberg - 10 dagar sedan
S ökar kraftigt i ny mätning från Sifo
" ..."
Tord Oscarsson - 10 dagar sedan
Den rosa drömmen kan bli en hård blå verklighet.
"jag läste nyss med intresse Katrine Kielos ledare i Aftonbladet idag. en ..."
Jan Andersson - 10 dagar sedan
Jag röstar på rosen!
"Vid dörrknackningen häromkvällen kom jag i samspråk med en väljare som ty..."
Joakim Jonsson - 10 dagar sedan
Den magiska siffran för oss valarbetare är 2,7 procent - skillnaden mellan ordning och kaos!
"Whaouw! Hämtar Svenska Dagbladet i brevlådan och läser på första sid..."
Bror Perjus - 10 dagar sedan
Nu får det vara nog
" Nedskärningarna inom kvinnosjukvården har fått förödande konsekvenser. B..."
Sjukvårdsvalet - 10 dagar sedan
Kommunal talar om hur snett Reinfeldt är ute
"Han är riktigt snett ute när det gäller så kallade traineejobb som S före..."
Lennart Holmlund - 10 dagar sedan
Socialdemokraterna framtidspartiet - nya visoner och förslag.
" Det handlar om allt från att unga ska få praktisera och jobba i..."
Björn Andersson - 10 dagar sedan
Moderaterna Kungälv
" Moderaterna kungälv..."
Glenn Ljunggren - 11 dagar sedan
Annie Lööfs (c) klavertramp
"Centerledaren Annie Lööf (c) har länge framstått som den verklige högerpo..."
Bengt Silfverstrand - 11 dagar sedan
Att läsa Arbetarhistoria hjälper oss att också förstå nuet
"Det vimlar inte av tidningar och tidskrifter som bidrar till fördjupad fö..."
Enn Kokk - 11 dagar sedan
Forssander har helt rätt, ja #sverigekanbättre...
"(illustr: Max Gustafson) För en stund sedan lyssnade jag på Anette Forss..."
Martin Moberg - 11 dagar sedan
Stefan Löfven och Henrik Fritzon: satsa på den skånska sjukvården
" Den svenska sjukvården håller över lag god standard, men det finns mång..."
Sjukvårdsvalet - 11 dagar sedan
Dags släppa taget om en föga tillförlitlig teori...
"Under dagen har jag läst om den granskning, som SVT:s Uppdrag granskning ..."
Martin Moberg - 11 dagar sedan
Skolpolitiken av idag, gör så att resultaten sjunker imorgon!
" Tänk om konflikterna i skolan är värre än vad vi tror!?..."
Björn Andersson - 11 dagar sedan
Min anmälan med kompletterande handlingar ivägskickade!
"Onsdagen den 10 september Anmälan till IVO med de kompletterande..."
Eva-Britt Dahlström - 11 dagar sedan
Skop 6 september S,V,Mp 176 mandat Alliansen 139 SD 34 Fi O
"S 32,0 V 8,3 Mp 79 = 48.2 = 176 mandat Alliansen M 22,0 Fp 5,8 C 5.3 Kd 5..."
Tord Oscarsson - 11 dagar sedan
Fyra dagar kvar
"Det är fyra dagar kvar innan valet söndagen den 14 september. I dag är de..."
Katarina Bredberg - 11 dagar sedan
Korruptionsanklagelser mot Bildt #val2014
"Georgi Chaindrava, fd minister i Georgien anklagar Bildt för korruption. ..."
Peter Johansson - 11 dagar sedan
Demoskop: Ökat gap mellan blocken
" Demoskop: Ökat gap mellan blocken Gapet mellan Alliansen..."
Tord Oscarsson - 11 dagar sedan
Om det var riksdagsval i dag, vilket parti skulle du rösta på då?
"48.1% S+V+MP 36.9% C+FP+KD+M S V MP FI SD Ö C FP KD M ..."
Tord Oscarsson - 11 dagar sedan
Allt börjar inte med en bra lärare
"Allt börjar inte bara med en bra lärare, utan med en politik som skapar f..."
Joakim Jonsson - 11 dagar sedan
Synliggör människan som städar i skepnad av Rut
"Jag delar inte alla ståndpunkter som Gudrun Schyman framför som talespers..."
Göran Johansson - 11 dagar sedan
(S) i Region Skåne vill införa drop-in-mottagning för bröstcancer
"Väntetiderna från misstanke om cancer, till diagnos och därefter behandli..."
Sjukvårdsvalet - 11 dagar sedan
Vad för samhälle vi ska ha avgör du på valdagen på söndag
"Vill du att vi ska ha samma politik som ska leda landet som vi har haft d..."
Roger Jönsson - 11 dagar sedan
Debatt på högskolan i Skövde
"Igår fick jag möjlighet att berätta om våra investeringar i högre utbildn..."
Monica Green - 11 dagar sedan
#val2014 - dags svetsa ihop Sverige på söndag
"Fyra dagar kvar till valet , som handlar om att fortsätta med det som let..."
Martin Moberg - 11 dagar sedan
Barn i fel skola riskerar sina livchanser
"För några dagar sedan rapporterade SVT om en undersökning från Skolverket..."
Göran Johansson - 11 dagar sedan
Jag tror inte på mirakel.
"Annie Lööf utropar enligt Expressen " Nu är det öppet race". Anledningen ..."
Jan Andersson - 11 dagar sedan
S skärper tonen – för att vinna valet
"S skärper tonen – för att vinna valet Löfven menar att det är stenhårt..."
Tord Oscarsson - 11 dagar sedan
BYE, BYE SEGREGATION - Vinster i skolan skall återinvesteras och skolan återigen bli statlig!
"På dagens 9/9 DNdebatt skriver ordföranden i Lärarnas riksförbund Bo Jans..."
Bo Widegren - 11 dagar sedan
Aktivitet på bloggen och valrörelse
"Jag fick ett meddelande om hög aktivitet på bloggen i dag. Lite förvånand..."
Mats Andersson - 11 dagar sedan
Wow, vilken kväll!!
"Kvällen började med en sväng till valstugan, där vi pratade bostadsbrist ..."
Joakim Jonsson - 12 dagar sedan
Därför talar vi Socialdemokrater inte så mycket om invandrare eller flyktingar!
" Idag undrade en kollega varför vi, i de andra partierna, inte pr..."
Björn Andersson - 12 dagar sedan
Det är inte gratis att dras med sjuka sjukförsäkringen
"(då i valet 2010 vart sjukförsäkringen ett fälleben för Reinfeldt...) De..."
Martin Moberg - 12 dagar sedan
#väljvälfärden - självklart, dags för arbetskläder...
"(dags för #väljvälfärden den 14/9...) Under förra veckan höll Socialdemo..."
Martin Moberg - 12 dagar sedan
Venstre upp i ny dansk mätning – på bekostnad av Dansk Folkeparti
"Voxmeters senaste mätning innehåller en del nya och intressanta trender –..."
Enn Kokk - 12 dagar sedan
#3 Freddie Talar fritt med Åsa Westlund
"Idag släpper vi det tredje podcast programmet i serien ”Freddie talar fri..."
Freddie Lundqvist - 12 dagar sedan
Haveriet i skolan är Reinfeldts draksådd
" Haveriet i skolan är Reinfeldts draksådd 9 SEPTEMBER 20..."
Tord Oscarsson - 12 dagar sedan
Mediastyrning och myror i byxorna
"Allt tätare opinionsmätningar och uppenbar medial styrning av opinionen t..."
Bengt Silfverstrand - 12 dagar sedan
"Margot Wallström som vill satsa på Kungälvsmodellen och folkbildning. "B..."
Glenn Ljunggren - 12 dagar sedan
Svensk Väljar opinion 25,8 - 16.9 2014 S V Mp 171 mandat Alliansen 140 , Sd 39
"S 30,0 Mp 9,9 V 7,2 = 47,1 171 mandat M 22,4 Fp 6,2 C 5,1 Kd 48 = 140 m..."
Tord Oscarsson - 12 dagar sedan
Dags för ny politik som inte sviker eleverna och lärarna
"Vill du att Sverige ska ha fyra år till av alliansens skolpolitik eller v..."
Roger Jönsson - 12 dagar sedan
Förtida röstning 2014 är 250 000 röster lägre än 2010 #val2014
"Jag har dag för dag studerat siffrorna för den förtida röstningen och för..."
Peter Johansson - 12 dagar sedan
Sonu genomsnitt i dag 9/9 S,V,Mp 175 Alliansen 137 SD 37
"Redigerat av Tord Oscarsson ..."
Tord Oscarsson - 12 dagar sedan
Vi har ett samarbete med Vänstern denna madatperiod
"Efter förra valet g jorde vi en överenskommelse med V för att Umeå ska ku..."
Lennart Holmlund - 12 dagar sedan
Mätningarnas mätning: S,V,Mp 47,8 Allinansen 38,4
"S 30,6 V 7,1 Mp 10,1 = 47,8 173 mandat M 22,3 Fp 6,3 C 5,2 Kd 4,6 = 3..."
Tord Oscarsson - 12 dagar sedan
Anders Holmensköld. Moderaterna
"Med anledning av artikel om All Care 2014-09-09 Anders Holmensköld v..."
Glenn Ljunggren - 12 dagar sedan
DN uppmärksammar vår idrottsmiljard
"Idag kan man läsa i DN Sport om vår idrottsmiljard! Jag gläds mycket åt a..."
Emilia Bjuggren - 12 dagar sedan
Systemet med utförsäkringar sliter sönder Sverige
" Anna-Karin Mattson har skrivit ett debattinlägg i den stora aftontidnin..."
Göran Johansson - 12 dagar sedan
Dags att välja välfärden, bl a sätta skolan först...
"(illustr: Robert Nyberg) Jag ska i dagens första inlägg ta upp situation..."
Martin Moberg - 12 dagar sedan
MFF i skuggan av valrörelsen
"På torsdag har UEFAs kommitté för bengalbrännare sammanträde, då får vi v..."
Peter Johansson - 12 dagar sedan
Se upp med korken som flyter ovanpå Allians-partierna
"Vi är bäst i spurten av alla partier! Det visar idag Dagens Nyhete..."
Bror Perjus - 12 dagar sedan
"Skriver i Piteå-Tidningen idag om blockblockeringen. Poängen är, för er..."
Stig-Björn Ljunggren - 12 dagar sedan
Moderaterna Kungälv.Whistleblower.
"Sverigedemokraterna Kungälv Det var ett pinsamt Kommunfullmäktige 2014-..."
Glenn Ljunggren - 12 dagar sedan
Matchen är inte avgjord.
"När SIFO förra veckan visade att gapet mellan de rödgröna och alliansen h..."
Jan Andersson - 12 dagar sedan
Om det var riksdagsval i dag, vilket parti skulle du rösta på då?
"48.1% S+V+MP 36.9% C+FP+KD+M S V MP FI SD Ö C FP KD M ..."
Tord Oscarsson - 12 dagar sedan
Först Västra Stambanan, tack!
"Naturligtvis är det bra med mer tåginvesteringar och riktiga framtidsatsn..."
Monica Green - 12 dagar sedan
SONU-genomsnitt* 8 sep S,V,Mp 171 mandat Alliansen 139 Sd 39
" SONU-genomsnitt* 8 sep ..."
Tord Oscarsson - 13 dagar sedan
5-7 september
"På fredagen gick SWE-bussen Göteborg-Helsingborg kl 8 och kostade 129 kro..."
Katarina Bredberg - 13 dagar sedan
8000 röster krävs för att vi ska bli historiska!
"Nås av beskedet via Facebook att det krävs ca 200 000 nya röster för att ..."
Joakim Jonsson - 13 dagar sedan
Ska du medverka i valrörelsen 2014?
"Så löd frågan den 5 augusti och i dag är det den 8 september och en dryg ..."
Katarina Bredberg - 13 dagar sedan
Är verkligen flyktingpolitiken dubbel så intressant som Bostadsbristen?
"När vi Socialdemokrater är ute och knackar dörr och ringer Sollentunaborn..."
Joakim Jonsson - 13 dagar sedan
Bedrövliga irrationella beteende av politiker i valrörelsen!
"Flera politiker får nu sparken eller avgår frivilligt. En ledande kristde..."
Björn Andersson - 13 dagar sedan
Ännu ett kvitto på en sjuk sjukförsäkring på dekis
"(foto: Per Malmborg) Under eftermiddagen läste jag ett inlägg på bloggen..."
Martin Moberg - 13 dagar sedan
Det är de två herrarnas tjänare som verkligen lyser
"Carlo Goldoni (1707-1793) skrev sin " Två herrars tjänare " (" Il servito..."
Enn Kokk - 13 dagar sedan
Vi satsar på dig - det handlar valet om
"Vi socialdemokrater går till val i år på att arbetslösheten ska minska, s..."
Roger Jönsson - 13 dagar sedan
När rasisterna goes foliehatt
" SD i Habo har gått foliehatt på allvar. Via Interasistmen hittar jag ov..."
Peter Johansson - 13 dagar sedan
Expressen Se Pollo of polls S,V,Mp 183 mandat Alliansen SD 133
"S 33,1 Mp 9,5 V 8,2 = 50.8 = 203 mandat M 22, 5 Fp 5,6 Kd 4,2 C 4,6 ..."
Tord Oscarsson - 13 dagar sedan
Vad återstår nu, bara några dagar kvar till valet!?
"Jo, att tala om jämlikhet! Att tala om att socialdemokratin vill ha e..."
Bror Perjus - 13 dagar sedan
Därför kan inte utförsäkringarna tillåtas fortsätta..
"Det här med att det ska finnas en schysst och värdig sjukförsäkring , har..."
Martin Moberg - 13 dagar sedan
Anders Borg uppträder som en riktig besserwisser
"Anders Borg fanns med i bakgrunden på 1990-talet när regeringen Bildt kör..."
Jan Andersson - 13 dagar sedan
Ännu längre provanställning, nej tack!
"(mer av detta vill Reinfeldt och regeringen se, ännu längre provanställni..."
Martin Moberg - 13 dagar sedan
Ängelholm är värt att satsa på
"Fredagen den 5 september besökte det socialdemokratiska regionrådet Henri..."
Sjukvårdsvalet - 13 dagar sedan
(S) lovar läkare till Hästveda
"På Hästveda vårdcentralsfilial ska det egentligen finnas en läkarmottagni..."
Sjukvårdsvalet - 13 dagar sedan
Samtliga fack stormar mot Reinfeldts krav på längre provanställning
"I borgerlighetens valmanifest finns hotet om att förlänga provanställning..."
Peter Johansson - 13 dagar sedan
Deras föräldrar dödades av Israels bomber
" Deras föräldrar dödades av Israels bomber ..."
Tord Oscarsson - 13 dagar sedan
Om det var riksdagsval i dag, vilket parti skulle du rösta på då?
"48.1% S+V+MP 36.9% C+FP+KD+M S V MP FI SD Ö C FP KD M ..."
Tord Oscarsson - 13 dagar sedan
Fakta för borgarbrackor och vilseledda väljare
"Borgarna brukar twittra och skicka siffror som säger att dom visst inte k..."
Leine Johansson - 13 dagar sedan
Nu växer avståndet Expressen Demosop visarr att tglappet mellan blocken är11,5 %
"Nu växer Alliansen backar. Det gör att avståndet mellan blocken ökar me..."
Tord Oscarsson - 13 dagar sedan
”Skarpa reformer för 40 miljarder i valmanifestet
" ”Skarpa reformer för 40 miljarder i valmanifestet” Publi..."
Tord Oscarsson - 13 dagar sedan
Stefan Löfven - debatten i SVT och talet i Kungsträdgården!
" Javisst ska vi öppna våra hjärtan för flyk..."
Björn Andersson - 14 dagar sedan
De osäkra väljarna vann debatten!
"Efter en lite tråkig valrörelse som mest handlade om "småfrågor" såsom fl..."
Joakim Jonsson - 14 dagar sedan
Stefan Löfven – Socialdemokraterna
" Stefan Löfven – Socialdemokraterna ..."
Tord Oscarsson - 14 dagar sedan
Du var bäst, Stefan!
"Ytterligare en debatt mellan Stefan Löfven och Fredrik Reinfeldt, denna g..."
Jan Andersson - 14 dagar sedan
Det är budbäraren det är fel på
"Det finns viktiga saker jag skiter i. Därför att den som säger det oftast..."
Calle Fridén - 14 dagar sedan
Vi behöver en demokratisk kommunal skola, utan Jan Björklund!
"Vi behöver en bättre skola. Kommunernas roll i skolan borde istället stär..."
Björn Andersson - 14 dagar sedan
Giftfri förskola. För alla.
" En förskola utan giftiga kemikalier Publicerad i Haningeposten Unde..."
Åsa Westlund - 14 dagar sedan
Ska man inte kunna anmäla till IVO utan att bli förföljd och utsättas för trakasserier?
"Söndag den 7 september Helt personligt. Det tycks för somlig..."
Eva-Britt Dahlström - 14 dagar sedan
Valprogram Socialdemokraterna i Gällivare
" Valprogram Socialdemokraterna Gällivare..."
Gällivareortens Socialdemokratiska Arbetarekommun - 14 dagar sedan
Svensson vill avskaffa pensionärsskatt
"Svensson vill avskaffa pensionärsskatt ..."
Tord Oscarsson - 14 dagar sedan
Älgkött får inte märkas som Svenskt Kött
"Visst är det konstigt när älgen har lvet häri Sverige och de svenska skog..."
Lennart Holmlund - 14 dagar sedan
Björklunds biljett?
"Någon sa att detta är Björklunds biljett ut.... jag säger att Sverige beh..."
Miguel Odhner - 14 dagar sedan
En film om drivkrafter i politiken
"Delar med mig vad älskade mor sa.......i en låda på mitt kontor ligger en..."
Miguel Odhner - 14 dagar sedan
Svensk skola kan och förtjänar bättre än så här...
"(tydlig socioekonomisk klyfta i svensk skola efter 8 år med Reinfeldt bil..."
Martin Moberg - 14 dagar sedan
#val2014 - väntan och pärsen är äntligen över snart...
"(dags att fasa ut fas 3 och Reinfeldt om en vecka...) Det är söndag idag..."
Martin Moberg - 14 dagar sedan
Klassamhället existerar, särskilt i Stockholm!
" Gatorna är fulla av tiggare. Folk är hemlösa. Moderaterna med Al..."
Björn Andersson - 14 dagar sedan
Det är diskriminering att pensionärer betalar högre skatt
"Den så kallade pensionnärsskaten är djupt orättvis och obegripligt. Den d..."
Lennart Holmlund - 14 dagar sedan
Var finns Allians-partiernas och Sverigedemokraternas gemensamma regeringsprogram?
"Sverigedemokraternas roll som stödparti för Alliansen har hittills i den ..."
Bror Perjus - 14 dagar sedan
Sju dagar tills Sverige kan lotsas framåt...
"(inte särdeles statsmannalikt agerat, medan samhällsproblemen växer - ill..."
Martin Moberg - 14 dagar sedan
En desperat, arrogant smått obalanserad Reinfeldt vevar DDR #val2014
"Fredrik Reinfeldt börja veva med DDR mot Stefan Löfven låter han sin inre..."
Peter Johansson - 14 dagar sedan
En vecka kvar...
"Nu gäller det att öka takten så att vi får till en förändring. Veckan som..."
Chatarina Holmberg - 14 dagar sedan

Göteborg Norrbotten Västerbotten Jämtland Västernorrland Gävleborg Dalarna Värmland Örebro län Västmanland Uppsala län Sörmland Gotland Kalmar län Blekinge Skåne Kronoberg Jönköpings län Halland Östergötland Stockholms län/Arbetarekommun Skaraborg Bohuslän Norra  lvsborg Södra  lvsborg Starta en egen hemsida och blogg