Varför skall vi ha en uppdelad skola?

Finns det någonting som visar, att vårt lands utbildning blir bättre med en uppdelning av skolan? Det som framförts som avgörande delar är - valfriheten? För föräldrar har detta blivit en ”symbol” för att kunna välja (även om det blir sämre!). Den gemensamma skolan betraktas generellt som ”sämre”, även om detta inte är förhållandet - bättre utbildning? På vilket sätt, måste man fråga sig? Det finns ingenting som visat sig vara bättre i den uppdelade, fria skolan. Det framförs att man bä...

» Läs hela inlägget

Postat av: C G Carlsson - 20 januari 19:00, 2012

Ämnen: usapolitikprivatiseringsverigeutbildningskolanfriskolorsvtsocialdemokratinlärarnas riksförbundriskkapitalbolaglärarfacketfriskolebolaggpskatteparadissegregeringpysslingenvalfrihetenmetta fjelknerbaggiumfriskolekoncerneracademediasr ekotuppdelningenden gemensamma skolanden fria skolanatheneskolanguernsey
Senaste blogginlägg
Rättvisa löner och full sysselsättning
"Lyssnade på ett seminarie med LO, där avtalssekreterare fanns med och dis..."
Leine Johansson - 4 timmar sedan
Kraftigt publiktapp på Almedalsveckan
"Läs mera här Almedalsveckan Gotland Visby. regering Socialdemokrat..."
Lennart Holmlund - 5 timmar sedan
Last Chorus: Conny Fredriksson
"En av mina gamla arbetskamrater på 68an , Socialdemokratiska partistyrels..."
Enn Kokk - 17 timmar sedan
Många svettades på loppisen på Mörkö – Södertälje –
"Många svettades på loppisen på Mörkö – Södertälje – : "Omkring ..."
Peter Karlberg - 17 timmar sedan
Jan Björklund och folkpartiet misstror människors kreativitet och energi
"Jan Björklund talade idag i Almedalen bland annat om ”curlingsamhället” -..."
Mario Matteoni - 18 timmar sedan
"Socialdemokraten" Jonas Sjöstedt (v) har talat
"Jonas Sjöstedt fokuserade i sitt tal i Almedalen igår starkt på barnfatti..."
Bengt Silfverstrand - 19 timmar sedan
Sommar i P1 med Edvard Moser
"Jag valde själv latinlinjen när jag gick i gymnasiet, så jag är inte särs..."
Enn Kokk - 19 timmar sedan
Almedalsveckan, hela listan
" Normal 0 21 ..."
Joakim Jonsson - 20 timmar sedan
Stora satsningar på äldrevården att vänta
" Normal 0 21 ..."
Joakim Jonsson - 20 timmar sedan
Dags för samhällsbyggande!
" Normal 0 21 ..."
Joakim Jonsson - 20 timmar sedan
Greklandskrisen leder inte till ett nytt Lehman Brother scenario
" Normal 0 21 ..."
Joakim Jonsson - 20 timmar sedan
Behövs folkrörelserna när vi har twitter?
" Normal 0 21 ..."
Joakim Jonsson - 20 timmar sedan
Ryanair ett bolag som inte tecknar kollektivavtal
"Den typen av bolag ska man inte åka med. Läs här Ryanair Kollektivav..."
Lennart Holmlund - 1 dagar sedan
Håll dej till höger Svensson
"Nu är sommartrafiken igång och det är fler på vägarna där jag bor och i r..."
Jan Paimo - 1 dagar sedan
Sommar i P1 med Liza Marklund
"Jag känner inte Liza Marklund personligen, men jag har läst och sett film..."
Enn Kokk - 2 dagar sedan
I framtidens Sverige finns bara VI - I vart fall när jag får inflytande.
"Dagens Anders, Dagens ämne är viktigt och handlar om varför tanken om V..."
Anders Forss - 2 dagar sedan
Politiker och arbetsskadeförsäkringen
"Ett intressant seminarie där LO bjöd in till debatt och diskussion kring ..."
Leine Johansson - 2 dagar sedan
Nej, moderaten Kinberg-Batra är inte smartare än lantisar....
"-Stockholmare är smartare än lantisar , det är ett -"varumärke" som moder..."
Bengt Silfverstrand - 2 dagar sedan
Vänsterpartist helt utan skam
"Riksdagskvinna i V som varit föräldraledig i våren går tillbaka i tjänst ..."
Lennart Holmlund - 2 dagar sedan
Melodikrysset nummer 27 2015
"Den plötsliga värmeböljan har, trots att vi har fläkt, förvandlat vår lan..."
Enn Kokk - 2 dagar sedan
Arvet från de fem
"Sverige är ett fantastiskt land att leva i. Just nu när detta skrivs är i..."
Roger Jönsson - 2 dagar sedan
USA avlyssnar sina vänner
"Det är illa hur USA beter sig. Läs mera här Usa Spioner Avlyssning ..."
Lennart Holmlund - 2 dagar sedan
Ja eller Nej i morgon?
"Den grekiska regeringens desperata kamp mot världens finanssystem har tvi..."
Mario Matteoni - 2 dagar sedan
Grekland, Tyskland och historien
"Historien kan inte utgöra facit för dagens ekonomiska politik. Men man k..."
Mario Matteoni - 2 dagar sedan
Kollektivet ALLTID starkare än individen!
"Dagens Anders, Dagens inlägg belyser varför ett kollektiv ALLTID är sta..."
Anders Forss - 2 dagar sedan
Moderat klavertramp i den bruna myllan....
"Som jag tidigare påpekat kliar det alltmer i den moderata högerpälsen. Fö..."
Bengt Silfverstrand - 3 dagar sedan
Jobb för unga, men till vilket pris?
"Besökte Visitas seminarie kring hur jobben för ungdomar sk kunna öka. Med..."
Leine Johansson - 3 dagar sedan
Sommar i P1 med Saga Becker
"Jag har homosexuella i min vän- och familjekrets och har, även om jag sjä..."
Enn Kokk - 3 dagar sedan
Almedalen skapar möjlighet till utveckling
"Noterar att Vi i Sollentunas chefredaktör mest tyckte Almedalsveckan hand..."
Joakim Jonsson - 3 dagar sedan
Visserligen fortsätter politikerveckan men….
"I kväll talar Anna Kindberg Batra i Alemdalen. Hon säger att hon vill bek..."
Monica Green - 3 dagar sedan
Tala klarspråk M i Skåne!
"I dagens Sydsvenskan går det att läsa en intressant artikel om de skånska..."
Roger Jönsson - 3 dagar sedan
Låt pensionfonderna investera i bostäder
"Då skulle pensionärerna få en bättre avkastning än idag. Läs mera här ..."
Lennart Holmlund - 3 dagar sedan
Återresan mot ett JÄMSTÄLLT Sverige startar NU!
"Dagens Anders, Dagens inlägg är skrivet i filosofiska anda med en stark..."
Anders Forss - 3 dagar sedan
Sommar i P1 med Kenneth Macartney
"Kenneth Macartney är Kanadas ambassadör i Sverige men talar, om än med vi..."
Enn Kokk - 4 dagar sedan
Du har väl inte glömt?
"Det måste påminnas! Det är förskräckligt! Det är fasansfullt! ..."
C G Carlsson - 4 dagar sedan
Stå kvar i hörnan?
"J ust nu befinner vi oss i en lågkonjunktur som har varit sedan 2008. Ojä..."
Roger Jönsson - 4 dagar sedan
Jimmy Åkesson (SD) och det gåtfulla folket....
"-Barn är ett folk och dom bor i ett främmande land, detta land är et..."
Bengt Silfverstrand - 4 dagar sedan
Obehagligt inslag i Almedalen
" Det kändes obehagligt att se hur den fina Almedalen plötsligt belamr..."
Monica Green - 4 dagar sedan
Invandringen är ingen kostnad
"Det är egentligen inte svårt att räkna ut. De allra flesta har någon utbi..."
Lennart Holmlund - 4 dagar sedan
Sommar i P1 med Georgios Karpathakis
"Giorgios Karpathakis hade ett mycket angeläget ämne för sitt Sommar -prog..."
Enn Kokk - 5 dagar sedan
Ebba Busch Thor (KD) är redan en SD-krigare......
"Interna SD-dokument visar att partiet velat värva KD-ledaren Ebba Busch T..."
Bengt Silfverstrand - 5 dagar sedan
Att migrationspolitiken lyfts i Almedalen skapar hopp om en bred parlamentarisk uppgörelse i frågan.
"Dagens Anders, Dagens inlägg tar fasta på att det nu verkar finnas hopp..."
Anders Forss - 5 dagar sedan
Vidga normen
"Kallis hyllar landslagets GULD Almedals minglet i går med Proffice som v..."
Leine Johansson - 5 dagar sedan
Västerbottens Kuriren borde skämmas
"Läs mera här Vk Tidning..."
Lennart Holmlund - 5 dagar sedan
Grattis Vårsta!
"Allmänna Arvsfonden har beviljat medel till Vårsta diakoni i ett treårigt..."
Sig-Britt Ahl - 6 dagar sedan
En t-shirt säger mer är 1000 ord
"Nu pustar vi ut efter UN-womens seminarie Egenmakt att återerövra livet. ..."
Monica Green - 6 dagar sedan
KD hår långre och längre högerut
"Läs mera här Politik Kristdemokratera Högerparti Sap..."
Lennart Holmlund - 6 dagar sedan
Sommar i P1 med Clara Henry
"Clara Henry pratar som en fors i sitt Sommar -program, och min hustru, so..."
Enn Kokk - 6 dagar sedan
Ingen ska skada sig på jobbet
"afa försäkringar som har hand om de kollektiva fösäringarna hade ett semi..."
Leine Johansson - 6 dagar sedan
Stefan Löfvens ofullbordade
"Stefan Löfven höll ett mycket engagerat och bitvis mycket starkt tal i Al..."
Bengt Silfverstrand - 6 dagar sedan
Stefan Löfvens tal fokuserade på utbildning, jobb och skola!
" Som socialdemokrat blev jag stolt över Stefan Löfvens Almedalst..."
Björn Andersson - 6 dagar sedan
Konsten att attrahera till Industri och teknik
"Industrin har svårare att rekrytera personal med rätt kompetens. Sandvike..."
Leine Johansson - 6 dagar sedan
Utmärkt att Löfvens tal i Almedalen följer Socialdemokratisk tradition.
"Dagens Anders, I dagens inlägg gör jag en historisk återblick till Olof..."
Anders Forss - 6 dagar sedan
Svag Venstre-regering ska manövrera Danmark
"Jag har leget lågt med att skriva om följderna av det danska valet. För e..."
Enn Kokk - 6 dagar sedan
Förvirrande om Grekland i TV
"Finska Yle sändning på svenska visar den 29 juni ett reportage från Grekl..."
Mario Matteoni - 7 dagar sedan
Sommar i P1 med Tom Alandh
"Dagens Sommar-pratare var journalisten och filmaren Tom Alandh. Här finns..."
Enn Kokk - 7 dagar sedan
Intensiva dagar i Visby
"Naturligtvis är jag på Gotland denna när politikerveckan i Visby pågår. J..."
Monica Green - 7 dagar sedan
Terror och terror dagliga rubriker
"I stort sett finns det dagliga rubriker om just terrorn och på det sätt d..."
Lennart Holmlund - 7 dagar sedan
Apropå Pride
"Här finns länk till Pride-festivalen i Varberg:"
Katarina Bredberg - 7 dagar sedan
Socialdemokraterna i Almedalen
" Almedalen..."
Katarina Bredberg - 7 dagar sedan
Tänk om - Tänk rätt Morgan Johansson!
"Dagens Anders, I dagens inlägg gör jag något som är både ovanligt och y..."
Anders Forss - 7 dagar sedan
Anpassa arbetsrätten till verkligheten
"LO-TCO Rättsskydd belyser en problematik som genomsyrat Sverige under en ..."
Leine Johansson - 7 dagar sedan
Moderaterna har skapat det "nya utanförskapet" som de idag ger Löfven en känga för!
" Moderaterna gör givetvis utspel för att locka fokusen från Soci..."
Björn Andersson - 7 dagar sedan
Bemanningsbranschen ett måste inom industrin
"Lyssnade på en paneldebatt i Almedalen där IKEM bjudit in bemanningsbrans..."
Leine Johansson - 7 dagar sedan
Trött centerledare i Almedalen
"Inte var det något drag i slöts tal. Jag tycker hon skjuter sig i foten n..."
Lennart Holmlund - 7 dagar sedan
Sänkt skatt för höginkomsttagare ger inte fler jobb!
" De som har en månadslön på mer än 36 900 kronor i månaden ska f..."
Björn Andersson - 8 dagar sedan
Ett axplock av förslag som ger hopp!
"Den politiska rapporteringen har under våren präglas av dåliga nyheter så..."
Joakim Jonsson - 8 dagar sedan
Sommar i P1 med Anna Mannheimer & Peter Apelgren
"Anna Mannheimers pappa Sören Mannheimer träffade jag regelbundet och lärd..."
Enn Kokk - 8 dagar sedan
Annie Lööfs (c) bluff som sprack
"Annie Lööf (c) är först ut av partiledarna när Almedalsveckan drar igång ..."
Bengt Silfverstrand - 8 dagar sedan
Det går inflation i begreppet kränkt !
" Det finns människor idag som vill använda ordet kränkt i samman..."
Björn Andersson - 8 dagar sedan
Alla lån måste betalas även Grekernas
"Det är den stora nyheten i dagarna då alla tröttnat på förhalningstaktike..."
Lennart Holmlund - 8 dagar sedan
Det ökande våldet resultatet av ett ojämlikt samhälle!
"Dagens Anders, Idag ger jag mig på en analys om varför våldet i samhäll..."
Anders Forss - 8 dagar sedan
EU utövar utpressning mot Grekland för att inte använda demokratin
"Skam går på torra land! EU är en omoralisk ockrare! Regeringen Tsipras ..."
Bo Widegren - 9 dagar sedan
Sollentunatidningen satsar på Almedalen
"Imorgon startar Almedalsveckan. Sollentunatidningen är som enda lokaltidn..."
Joakim Jonsson - 9 dagar sedan
Det är sällan jag har fel men i kväll hoppas jag det.
"Det beror på att jag tror Danmark vinner i kväll mot Sverige men hoppet l..."
Lennart Holmlund - 9 dagar sedan
Sommar i P1 med Mona Malm
"Mona Malm är 80 år gammal men har i dag, efter ett helt liv som folkkär s..."
Enn Kokk - 9 dagar sedan
Farväl till vapnen?
"Sverige ska inte få exportera vapen till stater med "grava demokratiska b..."
Bengt Silfverstrand - 9 dagar sedan
Melodikrysset nummer 26 2015
"Jo, jag har lyckats lösa också dagens melodikryss, trots att det innehöll..."
Enn Kokk - 9 dagar sedan
När är du svensk enligt Sverigedemokraterna?
" Året var 1986 och min gymnasieklass var på skolresa i Helsingbor..."
Björn Andersson - 9 dagar sedan
USA borde skämmas och be om offentlig ursäkt
"Att avlyssna franska presidenter är inte riktigt rätt. Läs mera här S..."
Lennart Holmlund - 9 dagar sedan
Balansen mellan offentlig och privat sektor.
"Dagens Anders, Dagens inlägg handlar om varför det är viktigt för Sveri..."
Anders Forss - 9 dagar sedan
Demokratin och kärleken segrar! Homo- och heterosexuella par likställs i Högsta domstolsutslag i USA.
"Likhet inför lagen, som saboteras av konservativa krafter! The first lin..."
Bo Widegren - 9 dagar sedan
Sommar i P1 med Bengt Baron
"Bengt Baron blev först känd som mycket framgångsrik simmare. I sitt Somma..."
Enn Kokk - 10 dagar sedan
Sjukskrivningarna ökade kraftigt under alliansen sista 4 år
"Här kan du läsa hur mycket sjukskrivningarna ökade sådan 2010. Klicka här..."
Lennart Holmlund - 10 dagar sedan
Omkring tiggarn från Rumänien....
"-Omkring tiggarn från Rumänien sprides irrläror hejvilt....* Samtidigt so..."
Bengt Silfverstrand - 10 dagar sedan
Svensk jämställdhet måste bli starkare
"  UN women och FN:s globala jämställdhetsprojekt HeForShe nådde Sver..."
Monica Green - 10 dagar sedan
Polisen måste följa lagen!
"Bra att inrikesminister Anders Ygeman säger ifrån: Det ska inte fi..."
Sig-Britt Ahl - 10 dagar sedan
Det är i Offentlig sektor de NYA jobben finns!
"Dagens Anders, Dagens inlägg visar att jag haft RÄTT hela tiden när jag..."
Anders Forss - 10 dagar sedan
Danska kommuner flyger inte med Ryanair
"Läs mera får du veta mer här Kollektivavtal Flygbolag Rayanair..."
Lennart Holmlund - 10 dagar sedan
Sommar i P1 med Terese Christiansson
"Sedan Expressen slutade publicera serier, har jag köpt och läst tidningen..."
Enn Kokk - 11 dagar sedan
Dags för Riksbanken att försvaga kronan?
"Om en vecka får vi reda på Riksbankens nästa steg för att få upp inflatio..."
Joakim Jonsson - 11 dagar sedan
Alliansens arbetslöshetssiffror har vi ärvt med deras misslyckade jobbpolitik!
"Förtroende för Stefan Löfvens och vårt parti fortsätter att sjunka. Och n..."
Björn Andersson - 11 dagar sedan
Kapitalismen Tillväxtmotor med LÅG verkningsgrad!
"Dagens Anders, Dagens inlägg tar upp och reder ut varför kapitalismen o..."
Anders Forss - 11 dagar sedan
Hur kan någon ha sådan tro att man blir självmordsbombare
"Jag tycker det är obegripligt. Det är klart att någon duperat de som bliv..."
Lennart Holmlund - 11 dagar sedan
Vart är du på väg?
"Läser Nisha Besaras utmärkta krönika om vår oförmåga att släppa in nya mä..."
Joakim Jonsson - 11 dagar sedan
Deppa inte Svensson, det ser ljust ut för Sverige!!
"En viktig faktor för att leva ett långt och frisk liv är enligt många läk..."
Joakim Jonsson - 11 dagar sedan
FN styrkor gör sexövergrepp på barn
"Man får aldrig slutas att bli förvånad. Läs mera genom en klick här F..."
Lennart Holmlund - 11 dagar sedan
Idag firar vi Boulogersjön
"Välkomna på socialdemokraternas sommaraktivitet vid Boulognersjön 25 juni..."
Monica Green - 11 dagar sedan
Rödgrön övervikt i norsk opinionsundersökning
"Arbeiderpartiet backar med 1,8 procentenheter och landar då på 36,8 proce..."
Enn Kokk - 12 dagar sedan
Agera nu för en bra skola!
"Återta greppet att skapa en gemensam, sammanhållen skola för alla Har vi ..."
C G Carlsson - 12 dagar sedan
Minns ni hur Billström som talman i hög röst sa åt finsnministern "käfta inte"?
"Jag påtalade detta den 24 mars 2015, alltså i anslutning till händelsen i..."
Bo Widegren - 12 dagar sedan
Sommar i P1 med Kalle Moraeus
"Dagens Sommar -värd, Kalle Moraeus , är som musiker känd bland annat geno..."
Enn Kokk - 12 dagar sedan
Kärnkraften avvecklar sig själv?
""Frisk vind i seglen för kärnkraftsmotståndet ", skriver Sydsvenskan/HD i..."
Bengt Silfverstrand - 12 dagar sedan
Individuell lönesättning är Demokratins DÖD - Kollektivavtal dess LIVRÄDDARE!
"Dagens Anders, Dagens inlägg beskriver och tydliggör varför den individ..."
Anders Forss - 12 dagar sedan
Blockpolitiken har kanske nått vägs ände
"   För en vecka sedan fick samarbetsregeringen äntligen igenom sin bud..."
Monica Green - 12 dagar sedan
Media behandlar politiker olika
"I den här länken har jag beskrivit några fall. Däremot tog jag inte med n..."
Lennart Holmlund - 12 dagar sedan
Almedalen en möjlighet
"Har fått möjlighet att åka till Almedalen i år. Att få diskutera och bli ..."
Leine Johansson - 12 dagar sedan
Almedalen-hälften så stor, men dubbelt så bra
"Nu är det bara några dagar kvar till årets politikervecka i Almedalen sta..."
Joakim Jonsson - 13 dagar sedan
Framtida kompetensförsörjning, öppet brev
"Öppet brev till ministrar: Ylva Johansson, Arbetsmarknadsminister, Sven-E..."
Sig-Britt Ahl - 13 dagar sedan
Den religiösa fanatikerna visar ingen hänsyn
"Så är det och i gen förstår och värst är IS. Läs mera här Ramadan Fa..."
Lennart Holmlund - 13 dagar sedan
Dagens Nyheter fortsätter försöka kväsa debatten om vår alliansfrihet
"Wolodarskis ”arkebusering” av Hirdman inte tillräckligt – Helmerson skänd..."
Bo Widegren - 13 dagar sedan
Finlands socialdemokrater nere på rekordlåg nivå
"Sosialidemokraattinen Puolue (Socialdemokratiska partiet) kom i valet den..."
Enn Kokk - 13 dagar sedan
Greklandskrisen blottar den öppna klasskampen
"Man kan beskriva den pågående kampen mellan Greklands regering och finans..."
Mario Matteoni - 13 dagar sedan
Sommar i P1 med Heléne Andersson
"Heléne Andersson , med den ovanliga yrkeskombinationen konstnär och polis..."
Enn Kokk - 13 dagar sedan
Kampen för ett jämlikt samhälle måste få en renässans!
"Dagens Anders, Dagens inlägg handlar om vikten av ett jämlikt samhälle...."
Anders Forss - 13 dagar sedan
Hur kunde det dåliga sommarvädret bli flyktingars fel?
" Det handlar om människor, individer, kvinnor, barn och äl..."
Björn Andersson - 13 dagar sedan
10 000 hundar åts upp på festival
"Tro det eller ej men det är faktiskt sant. Läs mera genom att klicka här ..."
Lennart Holmlund - 13 dagar sedan
Krigshetsarna Putin och Wolodarski. Varför kan vi inte sakligt diskutera NATO?
"Putin är en, men mer en pokerspelare, men Nato spelar med i krigsspelet. ..."
Bo Widegren - 14 dagar sedan
Att ha åsikter på nätet är inte politik på riktigt
"Det kan vara bra att komma ihåg det, i dessa dagar av bandhundsliknande s..."
Calle Fridén - 14 dagar sedan
Födelsedags- och midsommargäster
"Inför midsommar har vi tagit hjälp med städningen och gräsklippningen – r..."
Enn Kokk - 14 dagar sedan
Nu ses resultatet
"Under flera år har Sverige varit ett land där skatterna har sänkts samtid..."
Roger Jönsson - 14 dagar sedan
Sommar i P1 med Siavosh Derakhti
"Siavosh Derakhti är en intressant person med ett livsöde värt att ta del ..."
Enn Kokk - 14 dagar sedan
300 Svenska medborgare krigar för IS
"De lånar dessutom pengar för att åka dit. Dyra sms lån. Det är inte accep..."
Lennart Holmlund - 14 dagar sedan
Decemberöverenskommelsen på export?
"Så kan vi lägga ytterligare ett val bakom oss, där de etablerade partiern..."
Joakim Jonsson - 14 dagar sedan
KÄRLEK vs. GIRIGHET är rimliga referensramar för politiken!
"Dagens Anders, Dagens inlägg handlar om att vidga och fördjupa demokrat..."
Anders Forss - 14 dagar sedan
Bankerna försämrar servicen till alla och för miljardvinster
"Samtidigt som de fyra storbankerna rapporterar sina miljardvinster försök..."
Monica Green - 14 dagar sedan
Är Sannfinländare och Sverigedemokrater, alla rasister?
"Idag så börjar jag fundera på Finland och jämförelsen med vårt lilla gran..."
Björn Andersson - 14 dagar sedan
Republikanerna i USA är ett hot mot hela jordklotet
"Orsaken är enkel. De tror inte på den globala uppvärmningen som sker och ..."
Lennart Holmlund - 14 dagar sedan
Ska vi ändra kommunlagen så Alliansen får igenom sin budget?
"I tisdags förra veckan fällde landstingsoppositionen Stockholmsalliansens..."
Björn Andersson - 15 dagar sedan
Den ideologiska debatten lever!
"Dagens Anders, Dagens inlägg är en hyllning till den inställning Olof P..."
Anders Forss - 15 dagar sedan
Motviljan mot höjd fastighetsskatt kastar om partisympatier i Oslo
"Den 13 september genomförs kommunstyre- och fylketingsvalg i Norge. Inför..."
Enn Kokk - 15 dagar sedan
Estland: Partier utanför regeringen klarar sig bäst
"Den opinionsundersökning TNS Emor den 10-17 juni har gjort åt nyhetsbyrån..."
Enn Kokk - 15 dagar sedan
Sveriges grodor hotas
"Mig förvånar det inte om det beror på resistenta bakterier. Läs mera här ..."
Lennart Holmlund - 15 dagar sedan
Sommar i P1 med David Batra
"Jag känner förstås till David Batra som ståuppkomiker, vet också att han ..."
Enn Kokk - 15 dagar sedan
Var blev ni av ljuva drömmar?
""S-kongressen i Västerås gav dock vissa förhoppningar om en ljusnande fra..."
Bengt Silfverstrand - 15 dagar sedan
"I dagens "moderna" värld dominerar synsätt som säger att "kakan" (vår eko..."
Roger Jönsson - 15 dagar sedan
Svensk Damfotboll inte i topp längre
"det var bara att konstatera att Sverige räcker inte till längre. Tyvärr o..."
Lennart Holmlund - 15 dagar sedan
Folklig resning runt om i Europa.
"Dagens Anders, I dagens inlägg lyfter jag upp de protester som sker i E..."
Anders Forss - 15 dagar sedan
Säg vad du vill – men riskera inte bara kritik utan att bli hängd
"Emanuel Karlsten: Säg vad du vill – men var beredd på kritik – Kultur & N..."
Peter Karlberg - 16 dagar sedan
Sommar i P1 med Lena Olin
"Årets Sommar -serie i P1 började med ett mycket hörvärt program med Lena ..."
Enn Kokk - 16 dagar sedan
Att lyssna före att hoppa på
"När personpåhopp haglar och det är en polarisering i en debatt där nyanse..."
Roger Jönsson - 16 dagar sedan
Melodikrysset nummer 25 2015
"I dag höll jag nästan på att glömma bort Melodikrysset. Vi har midsommarg..."
Enn Kokk - 16 dagar sedan
Satsa nu på skolan!
"En successiv nedbrytning av skolan har skett De åtta åren med Högerregeri..."
C G Carlsson - 16 dagar sedan
Hushållens skuldsättning måste minska annars blir det bankkris
"Det är orimligt att tillåta att skulderna för hushållen bara ökar och öka..."
Lennart Holmlund - 16 dagar sedan
Danmark: Regeringsskifte men ett i flera avseenden överraskande valresultat
"Folketingsvalet i Danmark gav ett i flera avseenden överraskande resultat..."
Enn Kokk - 17 dagar sedan
Borgerligheten vill skyla över fattigdom och "förbjuda den"!
"Mauricio Rojas , som till stöd för sin framställning åberopar en docentt..."
Bo Widegren - 17 dagar sedan
Myter och människoförakt i flyktingdebatten...
"En stor studie slår hål på myten att tiggeriet i de skandinaviska ländern..."
Bengt Silfverstrand - 17 dagar sedan
Vad håller på att hända med Världen och Sverige?
"Dagens Anders, I dagens inlägg tar jag upp läget både i Sverige och i v..."
Anders Forss - 17 dagar sedan
Försvaret måste man ta tag från regeringens sida
"De motarbetar att det etableras vindkraft Försvaret Försvarsminister..."
Lennart Holmlund - 17 dagar sedan
Tragiskt på så många (S)ätt i Danmark
"Dags för danska S att se sig själv i spegeln på riktigt. För mig som inv..."
Olas tankar - 17 dagar sedan
Sverigedemokraterna har målat in sig i ett hörn.
"Danskt Folkparti gick sorgligt nog starkt framåt i valet igår. Med deras ..."
Björn Andersson - 17 dagar sedan
I Västerbotten firar vi midsommar med en klarblå himmel
"Nu är det vår tur att ha strålande sol från en klarblå himmel och det gör..."
Lennart Holmlund - 17 dagar sedan
Skriv av Greklands skulder annars hotas demokratin i Europa!
"Den grekiska krisen beror mycket på att den grekiska staten, under decenn..."
Mario Matteoni - 17 dagar sedan
Jag vill ha en levande debatt
"Men jag vill inte ha angrepp på enskilda individer - jag vill och hoppas ..."
Jan Paimo - 18 dagar sedan
Trevlig midsommar!
"Jag hade nog tänkt mig att lägga ner den här bloggen, men nu fick jag..."
Sig-Britt Ahl - 18 dagar sedan
He for She lansering
"Idag har UN-women Sverige deltagit i statsminister Stefan Löfvens natione..."
Monica Green - 18 dagar sedan
Med adress till Bernur, Björn Kihlström
"På Björn Kihlströms blogg – länk finns här intill – finns i dag en text v..."
Enn Kokk - 18 dagar sedan
Även murar kostar pengar...
""Flyktingfrågan måste upp till debatt", skriver Anders Forss i ett mycket..."
Bengt Silfverstrand - 18 dagar sedan
Ungerns politik idag, är Sverigedemokraternas politik i praktiken!
" Ungern väljer att sätta stängsel för att hindra flyktingar ta s..."
Björn Andersson - 18 dagar sedan
SvD:s ledarskribent: ”Ställ individen mot kollektiven!”
"Ledarskribenten på SvD, Nils-Erik Sandberg, tar i dag sats i Regeringsfor..."
Mario Matteoni - 18 dagar sedan
Vårändringsbudgeten lappar och lagar hål i välfärden
"DÖ höll helt väntat och nu börjar regeringen lappa en del hål som uppståt..."
Lennart Holmlund - 18 dagar sedan
Danska valet kan bli en rysare
"I morgon, den 18 juni, hålls folketingsval i Danmark. Socialdemokratiet..."
Enn Kokk - 19 dagar sedan
Personaluthyrning till Offentlig sektor måste STOPPAS!
"Dagens Anders, I dag ger jag mig på fenomenet med inhyrd personal inom ..."
Anders Forss - 19 dagar sedan
Opinionsläget i Norge
"I Norge hålls lokalval i höst, och eftersom utfallet brukar skilja sig åt..."
Enn Kokk - 19 dagar sedan
I Umeå ställde vänsterpartiet inte upp på att halvera barnfattigdomen
"Politiken tar märkliga vägar och att vänsterpartiet inte ställde upp på a..."
Lennart Holmlund - 19 dagar sedan
Från svångrem till svängrum?
"Decemberöverenskommelsen klarade som väntat första testet med glans. I mo..."
Bengt Silfverstrand - 19 dagar sedan
Det finns moderater som gärna skulle styra tillsammans med SD
"Visst är det så men de säger det inte öppet utan är kritiska mot December..."
Lennart Holmlund - 19 dagar sedan
Välkommen Phumzile
"Vi från UN women Sverige är glada att Phumzile Mlambo-Ngcuka besöker Sver..."
Monica Green - 19 dagar sedan
DÖ lever! Nu kör vi!
"Ikväll röstade riksdagen igenom s-regeringens vårändringsproposition och ..."
Joakim Jonsson - 20 dagar sedan
En film om det tidiga 1930-talets Centraleuropa
"Det faktum att Wes Andersons film från 2014 heter " The Grand Budapest Ho..."
Enn Kokk - 20 dagar sedan
SL- kortshöjningen blev stoppad av oppositionen i landstinget!
"SL-korts höjningen blir inte av. Alliansen hade tänkt sig höja månadskort..."
Björn Andersson - 20 dagar sedan
En jobbig händelse!
"Ibland har man otur. I datavärlden inträffar det då och då händelser s..."
C G Carlsson - 20 dagar sedan
Äntligen- tar Sverige en ny väg!
"Idag röstar vi i en historisk omröstning i riksdagen. Den gamla regering..."
Monica Green - 20 dagar sedan
Danmark två dagar före valet
"Läget inför det danska valet är ganska jämnt, men det finns mätningar enl..."
Enn Kokk - 20 dagar sedan
Till exempel med Absolut Peppar
"Jag har för egen del slutat dricka snaps, men välformulerade snapsvisor f..."
Enn Kokk - 20 dagar sedan
Idag röstas vårbudgeten äntligen igenom!
" Idag tisdagen den 16 juni så kommer regeringens första budget röstas ..."
Björn Andersson - 20 dagar sedan
Flyktingfrågan måste upp till debatt!
"Dagens Anders, I dagens inlägg vill jag lyfta upp frågan om att det är ..."
Anders Forss - 20 dagar sedan
Full fart - NOT?
"Den här veckan är det som vanligt högt tempo, många vill ha möten och kla..."
Monica Green - 20 dagar sedan
Finland har ett främlingsfientligt sittande i regeringen
"Finland brukar vara olika än i de flesta andra länderna. Det har varit ol..."
Lennart Holmlund - 20 dagar sedan
Är du smartare än en riksdagsledamot?
"I dagens nummer av Expressen räknar Anna Dahlberg upp ettantal problem so..."
Mario Matteoni - 21 dagar sedan
Det har förekommit hot inom HV71
"Det har vi fått reda på idag efter att styrelsen hoppade av igår och det ..."
Lennart Holmlund - 21 dagar sedan
Spännande inför valet i Danmark
"Sammanvägningarna av resultat i de olika opinionsmätningarna inför danska..."
Enn Kokk - 21 dagar sedan
Birgitta kom hem med ena ögat starropererat
"Birgitta tog bussen in till Uppsala i går kväll. Hon hade tid för starrop..."
Enn Kokk - 21 dagar sedan
Låt Viktoria bli Sveriges sista prinsessa och första president!
"Kungabarnens bröllop har kostat skattebetalarna över 60 miljoner kronor (..."
Mario Matteoni - 21 dagar sedan
Första gången på över 20 år som inte jag lägger fram S budgeten
"Så är det och jag saknar det inte en sekund. Nu är det Hans Lindberg som ..."
Lennart Holmlund - 21 dagar sedan
Utbyggd offentlig sektor skapar massor av nya jobb.
"Dagens Anders, Efter 2 dagar utan bloggande är jag nu tillbaka med förn..."
Anders Forss - 21 dagar sedan
Ett s-föreningsmöte, förlagt till Gräsö
"Gräsö är en stor, mycket långsträckt ö, den tionde i storlek i Sverige. D..."
Enn Kokk - 22 dagar sedan
Strategisk idealism
"Jag skrev i ett tidigare inlägg här på bloggen om begreppet "strategisk i..."
Stig-Björn Ljunggren - 22 dagar sedan
Socialdemokraterna i Estland på andra plats i färsk opinionsmätning
"Sotsiaaldemokraatlik Erakond , Socialdemokraterna i Estland ingår, efter ..."
Enn Kokk - 22 dagar sedan
Flest oslobor vill ha Arbeiderpartiets Raymond Johansen som byrådsledare
"Inför kommunalvalet i höst har Sentio Research på uppdrag av Klassekampen..."
Enn Kokk - 22 dagar sedan
Vi sossar har format om Umeå stadskärna till en vacker kärna
"Du som inte varit i Umrå på länge borde ta dig en titt på stadskärnan fra..."
Lennart Holmlund - 22 dagar sedan
Spännande i Danmark
"Eftersom jag i går var på Gräsö på sommarträff med min S-förening, hann j..."
Enn Kokk - 22 dagar sedan
Firade vi kärleken och hur harmlöst är det att åsidosätta demokratin?
"Vad står prinsyran för? Carl Philip sa från slottstrappan till den fo..."
Bo Widegren - 22 dagar sedan
Breivik vill inte kallas massmördare
"Men då är han ute och cyklar för är man inte massmördare när man skjuter ..."
Lennart Holmlund - 22 dagar sedan
Vindelfjällen är som en dröm
"Ja så är det och läs meta genom att klicka på länken där jag beskrivet i ..."
Lennart Holmlund - 23 dagar sedan
Sverige, vårt älskade land
"I grunden är Sverige ett fantastiskt land. När vi säger Sverige fylls vi ..."
Roger Jönsson - 23 dagar sedan
Tre elefanter i en porslinsbutik....
"-Skrota decemberöverenskommelsen och bilda majoritet tillsammans med Sver..."
Bengt Silfverstrand - 23 dagar sedan
Två män anhållna för mord
"När som sommaren ska vara som bäst, precis i början på allt det härliga, ..."
Monica Green - 23 dagar sedan
Melodikrysset nummer 24 2015
"I dag har vi haft en underbar sommarmorgon här i Öregrund. Trädgården blo..."
Enn Kokk - 23 dagar sedan
Ammarnäs en ort väl värt en semestervecka
"Det finns ett stort go framför allt bland unga i Ammarnäs som vill leva o..."
Lennart Holmlund - 23 dagar sedan
Gästbloggare Clara Zhong Bergander: Min praktik på Sveriges häftigaste arbetsplats
"Hej. Den här veckan är det jag som får äran att göra ett litet gästinlägg..."
Mathias Tegnér - 24 dagar sedan
Opinionsläget inför höstens kommunevalg i Norge
"I de norska kommunalvalen röstar folk inte identiskt med sitt röstbeteend..."
Enn Kokk - 24 dagar sedan
Fem dagar kvar till valet i Danmark
"Det sker inga häftiga förändringar i de opinionsmätningar jag dagligen åt..."
Enn Kokk - 24 dagar sedan
Det blir sänkt skatt för pensionärerna när regeringen får igenom sin budget
"Läs mera här Skatt Pensionärsskatt Regeringen Alliansen..."
Lennart Holmlund - 24 dagar sedan
Rättvisa, solidaritet, utveckling, trygghet
"Detta inlägg har tidigare publicerats i " I rörelse ". Politik handlar ..."
Lars G Linder - 24 dagar sedan
"Min webbfråga ligger ute sedan den 8 juni och jag försöker marknadsföra d..."
Katarina Bredberg - 24 dagar sedan
Seminarium + West Pride
"Jag kom precis från ett seminarium på Swedish Match, snusfabriken i Göteb..."
Katarina Bredberg - 24 dagar sedan
Svensk Näringsliv: bredda borgerligheten med brun samverkan för att gynna de besuttna
"På debatt i Dagens Industri i dag 12/6 har tre representanter för närings..."
Bo Widegren - 24 dagar sedan
Från ord till handling om den orättvisa pensionärsskatten
"    Under deras åtta år ökade borgerliga regeringen skillnaden mel..."
Monica Green - 24 dagar sedan
Alliansens budget gav mindre till äldreboenden
"Det är den budgeten som gäller då även SD ville straffa de äldre, mindre ..."
Lennart Holmlund - 24 dagar sedan
HURRA! - Frihandelsavtalet TTIP uppskjutet på obestämd framtid i EU parlamentet.
"Dagens Anders, I dagens inlägg tar jag på nytt upp de negativa effekter..."
Anders Forss - 24 dagar sedan
Polisen klarar inte arbetet med psykisk sjuka
"vill du läsa resten tryck här Polis Sjukvård Psysisk ohälsa...."
Lennart Holmlund - 25 dagar sedan
Vadå 1809?
"Hittade en text av mig själv på nätet som skrevs för några år sedan men s..."
Stig-Björn Ljunggren - 25 dagar sedan
Kaxigt, men inte mycket nytt under solen...
"Onsdagens partiledardebatt fördes i ett mycket högt och kaxigt tonläge. P..."
Bengt Silfverstrand - 25 dagar sedan
Dags att bygga bostäder, även i Sollentuna!
"Idag har vi debatterat bostadspolitik i Sollentuna kommunfullmäktige (du ..."
Joakim Jonsson - 25 dagar sedan
Danmark: Alternativet större än Konservative Folkeparti och i en del mätningar större än Radikale Venstre
"Till de kommentarer jag tidigare har publicerat till opinionsmätningarna ..."
Enn Kokk - 25 dagar sedan
Facket - en global demokratisk rättighet
"Antalet löntagare blir allt fler i världen, men också antalet kränkningar..."
Mario Matteoni - 25 dagar sedan
Cykla säkert
"    Cykla är ett utmärkt sätt att förflytta sig, det är en skön mo..."
Monica Green - 25 dagar sedan
Indisk politiker har sagt att kvinnor vill bli våldtagna
"Mycket ska man få höra innan öronen ramlar av men det uttalandet tror jag..."
Lennart Holmlund - 25 dagar sedan
Rör inte föräldraförsäkringen - Låt föräldrarna själva bestämma vem som ska vara hemma!
"Dagens Anders, Med dagens inlägg rör jag om i grytan ordentligt! I da..."
Anders Forss - 25 dagar sedan
Skolavslutning, och sommarlovet börjar även för morfar
"I måndags kväll åkte jag och Birgitta till Uppsala för att för sista gång..."
Enn Kokk - 26 dagar sedan
Danmark: Vänstervinden har mojnat, men det går uselt för det ledande borgerliga oppositionspartiet
"Några iakttagelser före redovisningen av dagens danska opinionsmätningarn..."
Enn Kokk - 26 dagar sedan
Liberal DN-spya på alla som vill resonera förnuft i NATO-frågan
"Bör DN efter skrynkling förpassas till utedasset? Dagens Nyheters hyc..."
Bo Widegren - 26 dagar sedan
Dagens partiledardebatt från TVn
"Idag följde jag partiledardebatten från TV, lite ovant eftersom jag bruka..."
Monica Green - 26 dagar sedan
Barn till personer med utvecklingsstörning diskrimineras
"Man blir både förbannad och ledsen när man hör att barn till föräldrar ti..."
Lennart Holmlund - 26 dagar sedan
Personalövertagande vid byte av entreprenör efter upphandling MÅSTE bli norm.
"Dagens Anders, Dagens inlägg handlar om offentlig upphandlingar och eff..."
Anders Forss - 26 dagar sedan
Dags för praktik
"I mars tog jag hjälp av Metro-jobb för att hitta en praktikant. Tanken va..."
Mathias Tegnér - 27 dagar sedan
Västerbottens Kuriren har en konstig syn på farlighet
"I går hade de besökt en park, en så kallad parkourpark till sammans med e..."
Lennart Holmlund - 27 dagar sedan
Grønland: Aleqa Hammonds kreditmissbruk större än man trodde
"Förra statsministern i Grønland, Aleqa Hammond , lämnade sitt ämbete när ..."
Enn Kokk - 27 dagar sedan
Danmark: Venstres stora misstag var att ha kvar Lars Løkke Rasmussen som ordförande
"Det största borgerliga partiet i Danmark, Venstre , som i folketingsvalet..."
Enn Kokk - 27 dagar sedan
Nya blåmärken och nya muskeldelar upptäckta
"Det blir bättre och bättre efter vurpan i söndags. Visserligen har jag sv..."
Monica Green - 27 dagar sedan
6 timmars arbetsdag är inte vägen framåt för ett bättre Sverige!
"Dagens Anders, I dagens inlägg ger jag mig på att kritisera Vänsterpart..."
Anders Forss - 27 dagar sedan
Hur Sture Bergwall valde sina "offer"
"Texten ovan är klippt från Sveriges radios blogg där docent Seppo Isotalo..."
Stefan Lindgren - 27 dagar sedan
Partival eller Personval?
"Dagens Anders, Dagens inlägg handlar om konsekvenserna av att begära ut..."
Anders Forss - 28 dagar sedan
Skall du demonstrera på 1 maj?
"Kategoriska svar denna gång: JA: 1/17 = 6 procent NEJ: 16..."
Katarina Bredberg - 28 dagar sedan
"En reflektion: ni som lämnar kommentarer ska lämna kontaktuppgifter. Kont..."
Katarina Bredberg - 28 dagar sedan
Vänsterseger, åtminstone med grönländskt och färöiskt stöd
"Också danska tidningar påpekar nu det jag tidigare har påpekat: För att v..."
Enn Kokk - 28 dagar sedan
KF säljer Akademibokhandeln och Bokus
"Det gamla vittförgrenade Kooperativa Förbundet har gradvis reducerats til..."
Enn Kokk - 28 dagar sedan
Bengt Berg på nationaldagen
"Bengt Berg heter en värmländsk poet, nu senast också politiskt verksam so..."
Enn Kokk - 28 dagar sedan
Tack Vätternrundan
"      Det blev ingen medalj för mig den här gången. Men en djups..."
Monica Green - 28 dagar sedan
Decemberöverenskommelsen odemokratisk?
"Sverigedemokraterna meddelade den 2 december 2014 att partiet hade för av..."
Björn Andersson - 28 dagar sedan
FI ett parti längst ute på vänsterkanten
"Det är väl egentligen ingen nyhet. Partiledaren kommer ju från yttersta v..."
Lennart Holmlund - 28 dagar sedan
Danmark: Det regnar opinionsmätningar
"Vi börjar som vanligt med resultatet i 2011 års folketingsval: Socialde..."
Enn Kokk - 28 dagar sedan
När brukarna blev kunder gick det åt helvete med skolan
"Tidsmässigt håller det ihop - att skolresultaten störtdök och det allmänn..."
Calle Fridén - 29 dagar sedan
"Håll käften, herr statsminister"
"Landets statsminister Stefan Löfven har uttryckt den i vissa kretsar tydl..."
Bengt Silfverstrand - 29 dagar sedan
Idé för framtiden
"Två stycken artiklar i dagens tidningar ger en bra beskrivning av hur de..."
Roger Jönsson - 29 dagar sedan
Kärlek & Solidaritet
"Dagens Anders, Kärlek & Solidaritet - Vem vill inte leva i ett samhälle..."
Anders Forss - 29 dagar sedan
Håll i pekpinnen!
"Landets statsminister har haft synpunkter på användandet av mobiltelefone..."
Stig-Björn Ljunggren - 29 dagar sedan
Norge: Ny mätning där Arbeiderpartiet åter ökar
"I den opinionsmätning Norfakta i början av juni har gjort för Klassekampe..."
Enn Kokk - 29 dagar sedan
Utländska ligor gör inbrott och bilstölder i Sverige
"Polisens kartläggning visar på detta och de kommer främst från Litauen oc..."
Lennart Holmlund - 29 dagar sedan
Tobias - man kan inte tvinga fram tacksamhet
"Tobias Billström trycker till Somar al Naher för hennes brist på tacksamh..."
Jan Paimo - 29 dagar sedan
Danmark: Dagens nya opinionsmätningar
"Vi börjar som vanligt med resultatet i 2011 års folketingsval: Socialde..."
Enn Kokk - 30 dagar sedan
Att blunda och att inte bry sig
"Det finns en oro i det svenska samhället. En oro för att framtiden inte b..."
Roger Jönsson - 30 dagar sedan
Moderater kan inte stava till solidaritet....
"Flyktingmottagandet i Sverige är mycket ojämnt fördelat mellan landets ko..."
Bengt Silfverstrand - 30 dagar sedan
Felsöka - Justera - Reparera!
"Dagens Anders, Dagens inlägg är en beskrivning av den agenda jag har fö..."
Anders Forss - 30 dagar sedan
Melodikrysset nummer 23 2015
"Vädret skiftar dag för dag. I går var det behaglig försommarvärme, och ja..."
Enn Kokk - 30 dagar sedan
Här stannar Sverige
"Så var det dags för demonstration/kortege igen. På 15 platser i Sverige o..."
Monica Green - 30 dagar sedan
Vägarna är sämst i Västerbottens län
"Der kommer fram i den undersökning som Motormännen gör men det är egentli..."
Lennart Holmlund - 30 dagar sedan
Spännande läge i danska valrörelsen – men vänstersidan har en chans att behålla regeringsmakten
"Opinionsmätningsföretagens resultat uppdateras och publiceras varje dag. ..."
Enn Kokk - 31 dagar sedan
Årets nationaldag kommer att bli en riktig höjdare.
"Det blir bara mer och mer att göra på Nationaldagen och det är väldigt ro..."
Monica Green - 31 dagar sedan
Ett par läsvärda bloggtexter
"Jag har tidigare presenterat de bloggar jag har i min bloggroll. Urvalet ..."
Enn Kokk - 31 dagar sedan
Om näsknäppar och Ljunggrensk domedagspredikan
"Säga vad man vill om socialdemokratin men även om partiets hegemoni som e..."
Bengt Silfverstrand - 31 dagar sedan
Skrota det fria vårdvalet!
"Dagens Anders I dag ger jag mig på "Det fria vårdvalet". Jag vill pås..."
Anders Forss - 31 dagar sedan
En annan bild av opinionsläget i Norge
"Här om dagen återgav jag en norsk opinionsundersökning, som bland annat i..."
Enn Kokk - 31 dagar sedan
Cyklister bör tänka mera på sig själva
"Jag tycker de bör vara lite mer rädda om sin hälsa. Var ute i ett projekt..."
Lennart Holmlund - 31 dagar sedan
Det behövs modiga politiker!
"Alltför länge har nättrollen fått ondgöra sig över de individer som reser..."
Tomas Gustafson - 32 dagar sedan
Finland: I spåren av valförlusten dras utgivningen av partitidningen Demokraatti ner
"Socialdemokraterna, Sosialidemokraattinen Puolue , gjorde nyligen ett use..."
Enn Kokk - 32 dagar sedan
Lettland: Ny president utsedd efter fem omröstningar i parlamentet
"I Lettland väljs presidenten av Saeima (Riksdagen), och den 3 juni var de..."
Enn Kokk - 32 dagar sedan
Norge: Arbeiderpartiet upp i en mätning inför det förestående kommunvalet men ner i en riksmätning
"I TNS Gallups kommunvalsbarometer för norska TV 2 ökar Arbeiderpartiet me..."
Enn Kokk - 32 dagar sedan
SLA utövar härstakrtknik
"   Sedan flera år tillbaka är min blogg länkad till Skaraborgs Alle..."
Monica Green - 32 dagar sedan
Ett samhälle ska bygga på jämlik vård!
"Nästan varje dag kommer rapporter om att tillväxten håller på att ta fart..."
Joakim Jonsson - 32 dagar sedan
Springschas hos Sickan Carlsson + en avdankad murvel
"Namn och Nytt i Dagens Nyheter bjuder på allehanda, ibland i kända hjulsp..."
Enn Kokk - 32 dagar sedan
Sverige och EU bör överväga en återgång till en strikt reglering av bank & finansmarknaden.
"Dagens Anders, I dagens inlägg ställer jag en fråga till mig själv likv..."
Anders Forss - 32 dagar sedan
Ny tillvaro på ny plats
"Den här bloggen har knappt uppdaterats sen disputationen för drygt ett oc..."
Marta Axner - 33 dagar sedan
Estland: Ung ryss vald till Socialdemokraternas ordförande
"Naturligtvis har den sovjetiska ockupationen av Estland – som medförde at..."
Enn Kokk - 33 dagar sedan
Danmark: Gapet mellan blocken försumbart litet – och nu lutar det åt vänsterseger
"Det fullkomligt regnar opinionsundersökningar fjorton dagar före det dans..."
Enn Kokk - 33 dagar sedan
Socialism är frihet - Socialism är KÄRLEK!
"Dagens Anders, Dagens inlägg behandlar skillnaderna mellan socialistisk..."
Anders Forss - 33 dagar sedan
Inrätta en bostadskommission i Sollentuna Kommun
"Det råder idag en stor bostadsbrist i Sollentuna och övriga delar av Stoc..."
Freddie Lundqvist - 33 dagar sedan
Historisk dålig opposition, men en annan väg är möjlig!
"Igår prickade KU regeringens agerande i en rad frågor och genast kopplade..."
Joakim Jonsson - 33 dagar sedan
Miljöpartiet orsaken till att bensinskatten höjs
"Det har Finansministern sagt Finansminister Besinskatt Miljöpartiet..."
Lennart Holmlund - 33 dagar sedan
Elbussar är framtidens stadsbussar i kollektivtrafiken.
"Dagens Anders, Som ett avbrott i skrivandet om skatteplanering och ekon..."
Anders Forss - 34 dagar sedan
En socialdemokratisk kongress, präglad av enighet och framtidstro
"Det jag främst slogs av, när jag som veteran och åhörare följde den socia..."
Enn Kokk - 34 dagar sedan
Då socialdemokratin spottade upp sig..
"Om man ville skaffa sig en någorlunda objektiv bild av vad som faktiskt f..."
Bengt Silfverstrand - 34 dagar sedan
Terrorrekryterare har anhållits
"Hoppas verkligen att polisen hittat rätt när två personer anhållits misst..."
Lennart Holmlund - 34 dagar sedan
Fyra steg tillbaka till 1990-talet
"Att läsa socialdemokratiska ledarsidor är som att gå på ett aktivistiskt ..."
Stig-Björn Ljunggren - 34 dagar sedan
Melodikrysset nummer 22 2015
"Jag kunde som sagt inte lösa Melodikrysset i direktsändning i lördags, ef..."
Enn Kokk - 34 dagar sedan
Löfven behövde skånsk hjälp – och fick det
"Publicerad i Västerbottens folkblad och Piteåtidningen 20150601 Det nya p..."
Tony Johansson - 35 dagar sedan
Det är desperation i Europa
"I Sverige har vi fått, och får vi, höra hur bra vi har klarat oss i förhå..."
Roger Jönsson - 35 dagar sedan
Skatteplanering skapar snedvriden konkurrens på olika villkor!
"Dagens Anders, Dagens inlägg handlar om något som är minst lika allvarl..."
Anders Forss - 35 dagar sedan
Ska Sollentuna gå med överskott, eller ska vi hushålla med resurserna?
"De senaste fem åren har Sollentuna kommun ackumulerat redovisat en vinst ..."
Joakim Jonsson - 35 dagar sedan
Ungdomssatsningar ger avkastning
"Inledda dagens som vanligt med att lyssna på P1 och noterade detta inslag..."
Joakim Jonsson - 35 dagar sedan
Att öppna sina grindar mot meningslöshetens hagar
"Jag skrev häromdagen om ”strategisk förlamning”inom arbetarrörelsen. De..."
Stig-Björn Ljunggren - 35 dagar sedan
Vi måste undvika en bostadsbubbla
"Finansinspektionen hade arbetat fram ett förslag som de skickade ut på re..."
Lennart Holmlund - 35 dagar sedan
Jag tar tillbaka det jag skrev om isis
"jJag tar tillbaka det jag skrev om isis. Jag har tänkt på det. Ni som har..."
Nils Erik Lindblom - 36 dagar sedan
Förklaring till varför siffran 95.000 miljarder i undanhållen skatt är så stor.
"Dagens Anders, Då många ifrågasatt siffran för storleken på hur mycket ..."
Anders Forss - 36 dagar sedan
För de få?
"I år är det sju år sedan som den ekonomiska krisen slog till mot Sverige ..."
Roger Jönsson - 36 dagar sedan
En fantastisk kongress
"Vilken känsla, vilket drag, vilket go vi har upplevt på den socialdemokra..."
Monica Green - 36 dagar sedan
Maud Olofsson styrde inte Vattefall utan det blev en dyr smäll
"Det är helt obegripligt att alliansregeringen trots varningar inte styrde..."
Lennart Holmlund - 36 dagar sedan
Därför ställer vi upp bakom ett samhälle för alla
"Idag har jag varit med om två starka upplevelser. I förmiddags deltog jag..."
Bengt Silfverstrand - 37 dagar sedan

Göteborg Norrbotten Västerbotten Jämtland Västernorrland Gävleborg Dalarna Värmland Örebro län Västmanland Uppsala län Sörmland Gotland Kalmar län Blekinge Skåne Kronoberg Jönköpings län Halland Östergötland Stockholms län/Arbetarekommun Skaraborg Bohuslän Norra  lvsborg Södra  lvsborg Starta en egen hemsida och blogg