Varför skall vi ha en uppdelad skola?

Finns det någonting som visar, att vårt lands utbildning blir bättre med en uppdelning av skolan? Det som framförts som avgörande delar är - valfriheten? För föräldrar har detta blivit en ”symbol” för att kunna välja (även om det blir sämre!). Den gemensamma skolan betraktas generellt som ”sämre”, även om detta inte är förhållandet - bättre utbildning? På vilket sätt, måste man fråga sig? Det finns ingenting som visat sig vara bättre i den uppdelade, fria skolan. Det framförs att man bä...

» Läs hela inlägget

Postat av: C G Carlsson - 20 januari 19:00, 2012

Ämnen: usapolitikprivatiseringsverigeutbildningskolanfriskolorsvtsocialdemokratinlärarnas riksförbundriskkapitalbolaglärarfacketfriskolebolaggpskatteparadissegregeringpysslingenvalfrihetenmetta fjelknerbaggiumfriskolekoncerneracademediasr ekotuppdelningenden gemensamma skolanden fria skolanatheneskolanguernsey
Senaste blogginlägg
Förändringar i den estniska septembermätningen
"Det svenska valet plus det faktum att opinionsmätningarna i Estland görs ..."
Enn Kokk - 9 minuter sedan
Socialdemokraterna och Miljöpartiet samarbetar i Region Skåne
"Idag meddelade Miljöpartiet och Socialdemokraterna i Skåne att partierna ..."
Sjukvårdsvalet - 1 timmar sedan
Svetsaren blir statsminister i dag
"Om allt går som det ska kommer vi att välja Stefan Löfven till statsminis..."
Monica Green - 4 timmar sedan
En pragmatisk statsminister är precis vad Sverige behöver.
"Förhandlingsuppgörelserna mellan S och MP har kommit under veckan. Media ..."
Jan Andersson - 5 timmar sedan
En helt Godkänd energiöverenskommelse
"Jag tycker att den överenskommelse som man gjort med Miljöpartiet är helt..."
Lennart Holmlund - 6 timmar sedan
Änget-Murbegsstaden Stor ledning för Socialdemokraterna
"Änget-Murbegsstaden ..."
Tord Oscarsson - 7 timmar sedan
2014 års cal i Härnösabd
" Visar resultat för valkrets: Härnösand ..."
Tord Oscarsson - 7 timmar sedan
Vräkt i ett modernt Sverige
"Under åtta år har det växt fram "riktigt fattiga människor" som inte har ..."
Leine Johansson - 8 timmar sedan
2014 års val i Västernorrland
" Visar resultat för riksdagsvalkrets: Västernorrlands ..."
Tord Oscarsson - 8 timmar sedan
När Pippi Långstrumps pappa blev politik!
"Det var plötsligt en dag som en liten flicka flyttade in i den där villan..."
Björn Andersson - 17 timmar sedan
Det är bra att det finns stater i USA som förbjuder plastpåsar
"USA är inte kända som ett land där miljön sitter i första rummet. Snarare..."
Lennart Holmlund - 17 timmar sedan
Tweets från seminariet om Svensk forskning om 1:1
" [ View the story "Svensk forskning om 1:1 – vilka slutsatser drar vi?" ..."
Peter Karlberg - 17 timmar sedan
Om flykten från Estland i Missionskyrkan i Östhammar
"Jag hade – av en slump samma dag som hustrun var inbjuden till Riksdagens..."
Enn Kokk - 21 timmar sedan
Nystart för Sverige
"Imorgon väljs Stefan Löfven till statsminister och på fredag läser han up..."
Joakim Jonsson - 22 timmar sedan
Ny mandatperiod – nya utmaningar
" Under valrörelsen har jag mött många som undrat vart Sverige är på väg. ..."
Bloggande Socialdemokrater i Halland - 22 timmar sedan
"I söndags kväll funkade plötsligt inte datorn här i Öregrund längre. Inte..."
Enn Kokk - 22 timmar sedan
Underskatta inte erfarenhet.
"För några dagar sedan tittade jag på TV och lyssnade på ett samtal mellan..."
Jan Andersson - 22 timmar sedan
Stor dag i Riksdagen
"Så var Riksdagsåret det så kallade Riksmötet högtidligt invigt. Det var ..."
Monica Green - 1 dagar sedan
Sanningen om talmansvalet: Det var de borgerliga partierna som valde Björn Söder.
"Valet av Sverigedemokraten Björn Söder till andre vice talman i Sveriges ..."
Bror Perjus - 1 dagar sedan
Svensk politik för en planet måste skapas
"Två representanter för Världsnaturfonden (WWF) konstaterar i ett debattin..."
Göran Johansson - 1 dagar sedan
Nu blir det en politik där jobben finns med som den viktigaste frågan
"Det är självklart att nu känner man igen partiet. Det finns ett program f..."
Lennart Holmlund - 1 dagar sedan
Vi människor i världen ska inte kriga ,mot varandra utan samarbeta.
"Jag har på mina arbetsplatser haft mycket god hjälp av kamrater från andr..."
Tord Oscarsson - 1 dagar sedan
S och MP eniga: Höjer a-kassan
" ..."
Tord Oscarsson - 2 dagar sedan
Nu höjs A-kassan -Löfvens viktigaste vallöfte infriat
"Nu höjs a-kassan Löfvens viktigaste vallöfte infriat ..."
Tord Oscarsson - 2 dagar sedan
Trixa med kulturarvet?
"En sak jag ofta funderar över, är hur vår moraliska kompass ändrar riktni..."
Jan Paimo - 2 dagar sedan
Skoltrötthet får aldrig vara ett argument för eller emot en obligatorisk skola!
"När jag var ung och vacker. Då jag skulle ut i arbetslivet. Då fanns det ..."
Björn Andersson - 2 dagar sedan
Tyvärr tror jag att SD tjänade på gårdagens demonstrationspolitik.
"Jag förstår att det kändes bra för majoriteten av riksdagens ledamöter nä..."
Jan Andersson - 2 dagar sedan
Riksdagen som plakatpolitisk samlingsplats
"Sverigedemokraterna har hystat hem typ 800 tusen röster. Många av dem är ..."
Stig-Björn Ljunggren - 2 dagar sedan
DN-ledare kallar 294 ledamöter av riksdagen för "infantila" - men agerar själv likadant!
"Normalisering pågår för fullt inom borgerligheten. Sverigedemokraterna, e..."
Bror Perjus - 2 dagar sedan
Det kom nya uppgörelser med miljöpartiet
"Det syns att visst går det bra att hitta lösningar med miljöpartiet och d..."
Lennart Holmlund - 2 dagar sedan
Lövfens stora ministerpussel -På fredag ska Stefan Löfven presentera sin regering.
" Lövfens stora ministerpussel Publicerad 30 sep 2014 05:20 ..."
Tord Oscarsson - 2 dagar sedan
Vad menar Henrik Fritzon med nyval?
"Folkpartiet i Skåne vill inte samarbeta med socialdemokraterna och miljöp..."
Jan Andersson - 3 dagar sedan
Urban blev lite överraskande ny talman
"Ja för mig var det lite överrraskande att Urban Ahlin blev ny talman. Nog..."
Lennart Holmlund - 3 dagar sedan
Moderaternas negativa och lögnaktiga valrörelsen slog tillbaka på dem själva!
"Det förra regeringspartiet Moderaternas kampanj gjorde inte att partiet v..."
Björn Andersson - 3 dagar sedan
Välkommen Erik
"Härligt att vi äntligen är 5 Socialdemokratiska Riksdagsledamöter från Sk..."
Monica Green - 3 dagar sedan
Förslag från en som är berusad av sin egen vänsterretorik
"Daniel Suhonen som gjorts till talesperson för den socialdemokratiska ”vä..."
Mario Matteoni - 3 dagar sedan
Grattis Urban
"Nu har vi valt min vän och kollega Urban Ahlin till Talman för Sveriges R..."
Monica Green - 3 dagar sedan
Urban Ahlin ny talman
" Grattis Urban till ditt nya uppdrag! Riksdagsledamot sedan 1994...."
Domsjö S förening - 3 dagar sedan
" Pakistan..."
Katarina Bredberg - 3 dagar sedan
Ny vecka
"Först fixa månadskortet till Jonatan och sen gå över till valnämndens kan..."
Katarina Bredberg - 3 dagar sedan
Majoren utkämpade ett förlorat slag, ridande på mycket trötta käpphästar.
"Igår framträdde i Agenda en parentes i den svenska skolans historia. En p..."
Bror Perjus - 3 dagar sedan
Upprop och nystart
"Idag är det upprop i Riksdagen och avstamp för en spännande politisk höst..."
Monica Green - 3 dagar sedan
En kommande regeringsbildare
"Regeringsbildare Det blir en intressant vecka som startar idag. Under m..."
Göran Johansson - 3 dagar sedan
I går kom den första uppgörelsen mellan Socialdemokraterna och Miljöpartiet
"Det var nog ganska självklart att den första uppgörelsen som skulle komma..."
Lennart Holmlund - 3 dagar sedan
Eventuellt en ny skolminister och en ny skolpolitik idag!
"Obligatoriskt gymnasium, högre lärarlöner och mindre klasser - nu är Milj..."
Björn Andersson - 4 dagar sedan
En ansvarslös regering har snart sjappat och lämnat efter sig en tom statskassa!
"Max Gustavsson ritar politiska bilder som väcker tankar. Denna bild, läng..."
Björn Andersson - 4 dagar sedan
Filmiskt mer utstuderat – men med utdragna actionavsnitt som eftergift
"Jag har genom åren sett alla James Bond-filmer, dels på bio, dels på VHS ..."
Enn Kokk - 4 dagar sedan
Vår strategi gentemot SD har varit misslyckad.
"Den stora vinnaren i årets val är Sverigedemokraterna. SD är nu Sveriges ..."
Jan Andersson - 4 dagar sedan
Anna Maria Corazza Bildt skjuter vilt
"I ett debattinlägg avlossar Anna Maria Corazza Bildt en formidabel bredsi..."
Göran Johansson - 4 dagar sedan
Kan en ny bok väcka vänstern till studier av kapitalismen?
"Vi som var röda och entusiastiska i början av 1960-talet och som sökte en..."
Mario Matteoni - 4 dagar sedan
Fånga vinden
"Det har nu gått två veckor sedan det var val. Ett val som gjorde att alli..."
Roger Jönsson - 4 dagar sedan
Kan man lita på miljöpartiet?
"Ja, även om måste erkänna att Gustav Fridolin har imponerat som trovärdi..."
Bengt Silfverstrand - 4 dagar sedan
En vätebomb har sprängts, motsvarande 4 600 Hiroshima-bomber. Men var lugn "krutet är torrt"
"Nu hotar Mats Johansson med kärnvapenkrig i Svenska Dagbladet. Vicken djä..."
Bror Perjus - 4 dagar sedan
Bidra till ett mer jämställt Sverige
"Thomas af Bjur, aktiv för Folkpartiet inom den sörmländska landstingspoli..."
Göran Johansson - 4 dagar sedan
Per-Anders Lundström om andra världskriget
" God morgon, Tord! Har du varit soldat? frågade mina dött..."
Tord Oscarsson - 4 dagar sedan
Det får konsekvenser att köra bil när man är full
"Ja det ska det också göra men det är märkligt att en toppidrottsman gör d..."
Lennart Holmlund - 4 dagar sedan
Danmark: Borgerliga Venstre uppe på sin gamla nivå
"Också i Voxmeters senaste mätning leder det borgerliga oppositionspartiet..."
Enn Kokk - 5 dagar sedan
Kanske har jag nedvärderat och underskattat Aftonbladet allt för mycket!?
"Kanske har jag nedvärderat och underskattat Aftonbladet allt för mycket!?..."
Bror Perjus - 5 dagar sedan
Västra Götaland
" Västra götaland..."
Katarina Bredberg - 5 dagar sedan
Västra Götaland
" Västra götaland..."
Katarina Bredberg - 5 dagar sedan
Politiken efter valet 2014
"Mycket kan sägas om valet 2014. Mycket kan sägas om rösträkning, i alla f..."
Katarina Bredberg - 5 dagar sedan
Stefan Löven blir statsminister S,VMp och övriga i regeringen har chans till majoritet
"Löfven ska träffa alliansens ledare ..."
Tord Oscarsson - 5 dagar sedan
Allt tyder på maktskifte
" ..."
Tord Oscarsson - 5 dagar sedan
Om reningsbad och Lena Mellins underbetyg i matematik
"Igår genomgick jag något som väl mest liknar ett reningsbad för själen. J..."
Bengt Silfverstrand - 5 dagar sedan
Melodikrysset nummer 39 2014
"I går kväll regnade det. I dag är himlen blå men vinden höstkylig. Det kä..."
Enn Kokk - 5 dagar sedan
Jag tror på Stefan Löfven.
"Tillbaka igen efter nästan en vecka i Bryssel. Ines och jag har fungerat ..."
Jan Andersson - 5 dagar sedan
2014 års val i Västernorrland
" ..."
Tord Oscarsson - 5 dagar sedan
Se 2014 års valresultat
" Uppdaterad 2014-09-14 20:53. Public..."
Tord Oscarsson - 5 dagar sedan
Svenska väljarna: Vi ångrar oss inte
" ..."
Tord Oscarsson - 5 dagar sedan
Ibrahim Baylan eller Gustav Fridolin, vem bryr sig?
"Det blir inte Ibrahim Baylan om väljarna får välja. Det finns tydligen et..."
Björn Andersson - 6 dagar sedan
Hösten, hösten, hösten, hösten
"Förra veckohelgen tillbringade vi i Uppsala, bland annat för att vi hade ..."
Enn Kokk - 6 dagar sedan
Med en historiskt svag regering bör vi lägga kraften på en vitalisering av "rörelsen"
"Nu handlar det om att ”övervintra” i fyra år, om inte Sverigedemokraterna..."
Bror Perjus - 6 dagar sedan
Srefan Löfven: Här du din regering
"Valet 2014 Så här försöker Löfven pussla ihop regeringen P..."
Tord Oscarsson - 6 dagar sedan
Boebde och personal på äldreboende smittades av Skabb- nu är probemet löst
" Problem med skabb har lösts ..."
Tord Oscarsson - 6 dagar sedan
Så får kvinnor lägre inkomst och pension
"Delegationen för jämställdhet i arbetslivet presenterade under gårdagen e..."
Göran Johansson - 6 dagar sedan
Susanne Eberstein bli Sveriges nästa talman
"Publicerad 2014-09-25 15:37 Skriv ut Öka text..."
Tord Oscarsson - 6 dagar sedan
M*ätningarnas mätning 13 september S,V,Mp 46,9 Alliansen 36,2 Sd 9.9
"--* S.V.Mp 46,9 Alliansen 36,2 SD 9,9 Redigerat..."
Tord Oscarsson - 6 dagar sedan
S,V,Mp 45,3 Alliansen 39.8 Sd 10.9 Fi 3,1
" SONU-genomsnitt* 22 sep ..."
Tord Oscarsson - 6 dagar sedan
Nya ridskolan tar form i Härnösand
" Nya ridskolan..."
Tord Oscarsson - 6 dagar sedan
Inte f*n är vi integrerade
"Foto: Som alla som deltog i valrörelsen känner till så..."
Olas tankar - 7 dagar sedan
Ny skylt ska marknadsföra Härnösand
" Ny skylt..."
Tord Oscarsson - 7 dagar sedan
Efter De Grönas avhopp har den finska regeringen fortfarande en knapp parlamentarisk majoritet – men inte i opinionen
"Den sittande regeringen i Finland bildades som en bred, blocköverskridand..."
Enn Kokk - 7 dagar sedan
Jag tycker visst att Susanne Eberstein kan bli talman.
Tord Oscarsson - 7 dagar sedan
Bok och biblioteksmässan
"Pustar ut efter en intensiv dag på bok och biblioteksmässan i Göteborg. D..."
Monica Green - 7 dagar sedan
Lyssna till Calmfors!
"Den nya regeringen, vilken den än blir, bör lyssna till ekonomen Lars Cal..."
Mario Matteoni - 7 dagar sedan
Allt tyder på maktskifte S,V Mp kommer att samataa med Stefan Lövfen
"Jag vill framhålla att Stefan Löfven blir statsminister - Tord Oscarsson ..."
Tord Oscarsson - 7 dagar sedan
Socialdemokraterna går ihop med Vänsterpartiet
"Socialdemokraterna går ihop med Vänsterpartiet ..."
Tord Oscarsson - 7 dagar sedan
Vårdnadsbidraget är en kvinnofälla
"I en debattartikel 20/9 ("
Freddie Lundqvist - 7 dagar sedan
Ökande löneskillnader
"LO presenterade igår sin senaste lönerapport. Den visar i korthet att tjä..."
Göran Johansson - 7 dagar sedan
Stefan Löven är statsminister och leder S,V,Mp
" ”Han har en färdig lista” Hård kamp om ministerpost..."
Tord Oscarsson - 7 dagar sedan
Stefan Löfem är beredd att samarbeta med S,V,Mp som en samlad regering
"Startsidan / Ledare / Ledarkrönika / Karin Pettersson 2014-09-25 Ka..."
Tord Oscarsson - 7 dagar sedan
Ingen vet hur stort svartarbetet är i rutbranschen
"Svart, vitt eller grått? Många debattörer hävdar att det svarta arbetet..."
Göran Johansson - 7 dagar sedan
Stefan Löfven - fortfarande segrare hos svenskarna
" Stefan Löfven - fortfarande segrare hos svenskarna. Fo..."
Tord Oscarsson - 7 dagar sedan
Alternativa "nobelpriset" gör att man inte skäms ögonen ur sig - Norska Nobelstiftelsen och Carl Bildt kan ta sig i häcken!
"Nobelpriset till Snowden? Jag har skrivit ett 10-tal bloggartiklar om at..."
Bo Widegren - 8 dagar sedan
Har du förtidsröstat?
"Så löd frågan den 8 september, i dag är det 24 september, 16 dagar har pa..."
Katarina Bredberg - 8 dagar sedan
Valet 2014
"Mycket kan sägas om valet 2014 men här är min berättelse: Söndage..."
Katarina Bredberg - 8 dagar sedan
En tidig film noir-thriller
"Billy (egentligen Samuel ) Wilder (1906-1902) föddes i Galizien, numera e..."
Enn Kokk - 8 dagar sedan
De rödgröna misslyckades med samtalet
"Det handlar inte bara om vem som säger saker. Det handlar också om var ma..."
Calle Fridén - 8 dagar sedan
Sverigedemokraternas arbetsmarknadspolitik.
" Idag kan vi svart på vitt se där Sverigedemokraterna gick fram och fic..."
Björn Andersson - 8 dagar sedan
Löfven: Samtalen med MP går framåt
" ..."
Tord Oscarsson - 8 dagar sedan
De rödgröna växer enligt Novus senaste undersökning
"Partiledarna om Novus senaste opinionsmätning artikel lördag 13/9 kl 10..."
Tord Oscarsson - 8 dagar sedan
Alliansens sista suck
"Som jag tidigare har skrivit talar allt för att Sverige får en ny minorit..."
Joakim Jonsson - 8 dagar sedan
Lögn eller sanning?
"På Facebook skriver en person som kallar sig ”Jonas Andersson” om hur han..."
Mario Matteoni - 8 dagar sedan
KI: Konjunkturen tappar fart
"KI: Konjunkturen tappar fart ..."
Tord Oscarsson - 8 dagar sedan
Val 2014 Socialdemokraterna är 8 % större än Moderaterna
" Val 2014 ..."
Tord Oscarsson - 8 dagar sedan
S,V,Mp är överens om att samarbeta
" ..."
Tord Oscarsson - 8 dagar sedan
Fastighetsskatt är mindre skadlig än andra skatter
"Tidningen Dagens Industri har talat med nationalekonomen Lars Calmfors. H..."
Göran Johansson - 8 dagar sedan
Se 2014 års valresultat i Väsatwrnorrland Stor ledning för de rödgröna
"Valet 2014 Se 2014 års valresultat Uppdaterad 2014-..."
Tord Oscarsson - 8 dagar sedan
Förhandlinmgar pågår om samarbete mellan S,V,Mp
"Valet 2014 Publicerad i dag 06:00 Allt om: Valet 201..."
Tord Oscarsson - 8 dagar sedan
Samarbete mellan S och V i landstinget
" ..."
Tord Oscarsson - 8 dagar sedan
Jonas Sjöstedt V vill sasmarbeta med Stefan Löfven
" Startsidan / Nyheter / Valåret 2014 2014-09-24..."
Tord Oscarsson - 8 dagar sedan
Tack för förtroendet, nu börjar det igen
"Nu har nya Riksdagsgruppen 113 ledamöter för socialdemokraterna träffats...."
Monica Green - 8 dagar sedan
Djävulsdansen - ett program om medberoende!
" Idag är jag fortfarande krasslig.. Jag är inte ofta sjuk...."
Björn Andersson - 9 dagar sedan
Nu får Sverige en regering med många från Norrland. Reinfeldt och Borg har avgått
"Ni som tror att Norrland är nöjd med alliansregeringen ska vet att vi nu ..."
Tord Oscarsson - 9 dagar sedan
Stefan Löfven har alla förutsättningar att bli hela sveriges statsminister
"På fredag kommer all medialjus på Stefan Löfven igen. Då går ju talmannen..."
Joakim Jonsson - 9 dagar sedan
Svenska kandidater fortsätter att väljas in i Finlands riksdag, Eduskunta, även om Svenska Folkpartiets ställning har försvagats
"Svenska Folkpartiet skiljer sig från övriga politiska partier i Finland g..."
Enn Kokk - 9 dagar sedan
Fortsatt debatt om Putins "bluff"
"Putin blinkar till Barosso. En bluffmakare till en annan? Tre Fi..."
Stefan Lindgren - 9 dagar sedan
Bönderna får betala för sanktionerna mot Ryssland
"Jag har ett fletal gånger tagit upp att vi måste få en jordbruskpolitik i..."
Lennart Holmlund - 9 dagar sedan
Magdalena Andersson om samtalen med miljöpartiet - BVi har väldigt bra samtal
" ''' Fullscreen ..."
Tord Oscarsson - 9 dagar sedan
Lokaljournalistiken segrar i valet
"Under det senaste åren har vi sett hur de stora mediehusen drar ned på lo..."
Joakim Jonsson - 9 dagar sedan
Förhandlingar pågår!
"Socialdemokraterna och Miljöpartiet har inlett förhandlingar om den komma..."
Göran Johansson - 9 dagar sedan
FP-väljare positiva till att regera med S
" ..."
Tord Oscarsson - 9 dagar sedan
Torgny Lindgren i regi av Bo Widerberg
"Torgny Lindgren (född 1938 i Norsjö i Västerbotten) valdes 1991 in i Sven..."
Enn Kokk - 10 dagar sedan
Stefan Löfven - fortfarande segrare hos svenskarna.
"Stefan Löfven - fortfarande segrare hos svenskarna Sverige har i 2014 års..."
Tord Oscarsson - 10 dagar sedan
Löfven har råd att låta folk bli friska
"Löfven har råd att låta folk bli friska TUFFT UPPDRAG S-ledaren S..."
Tord Oscarsson - 10 dagar sedan
Ska media sluta granska Sverigedemokraterna?
"En efter en politiker avgår efter märkliga uttalande, hatinlägg på nätet ..."
Björn Andersson - 10 dagar sedan
Ny mandatperiod - nya tag - nytt ansvar!
"Valet är över och folket har sagt sitt om att det är dags för förändring...."
Monica Green - 10 dagar sedan
Nu är det dags att ta matchen!
"När jag vaknade i måndags förra veckan gjorde jag det med sorg. Nästan 80..."
Tomas Gustafson - 10 dagar sedan
Moderaterna väljer en efterträdare till Fredrik Reinfeldt på en extrastämma den 7 mars.
" Moderaterna väljer en efterträdare till Fredrik Reinfeldt på en extras..."
Tord Oscarsson - 10 dagar sedan
En förklaring och en stilla fråga
"Jag skrev tidigare idag om att det verkar vara något väldigt, väldigt fel..."
Olas tankar - 10 dagar sedan
Så påverkas ekonomin om det blir nyval
"Så påverkas ekonomin om det blir nyval "Viktigast är att vi får veta v..."
Tord Oscarsson - 10 dagar sedan
Upplevelsen av att vara lämnad utanför
"TV-programmet Agenda sände igår kväl en intervju med den tidigare ordföra..."
Göran Johansson - 10 dagar sedan
Det verkar gå sådär med rösträkningen
"Länsstyrelsen håller som bäst på och räknar personrösterna i kommunerna. ..."
Olas tankar - 10 dagar sedan
Upplysningar till dem som inte känt vindriktningen....
"Jag har i några blogginlägg försökt föra in eftervalsdebatten på de spår ..."
Bengt Silfverstrand - 10 dagar sedan
Därför växer SD. Och större kan de bli.
"Publicerad i Piteåtidningen och Västerbottens folkblad 20140922 Valvaka. ..."
Tony Johansson - 10 dagar sedan
Arbetsförmedlingen – en vänthall för arbetslösa
"Vänthallen Igår kväll såg jag ett program som SVT producerat – " Vägen ..."
Göran Johansson - 10 dagar sedan
Nu måste vi får en regering som vill utveckla hela Sverige och inre bara Sthlm med omnejd
"Det som hänt i 2014 års val glädjer mig som Norrlänning. Jag har upplevt..."
Tord Oscarsson - 10 dagar sedan
2014 ärs val S,V,Mp 159 mandat Alliansen 142 mandat
"Parti Partiledare Röster Mandatfördelning Antal % ..."
Tord Oscarsson - 10 dagar sedan
:Löfven får bilda regering
" ..."
Tord Oscarsson - 10 dagar sedan
Min socialdemokrati
"Jag är besviken på partiets hållning/inriktning i flera centrala frågor. ..."
C G Carlsson - 11 dagar sedan
Norge: Den blå-blå regeringen närmar sig förra valresultatet. Arbeiderpartiet håller ställningen, men SV åter under spärren
"Den blå-blå regeringen i Norge stärker åter sin position i opinionen. I..."
Enn Kokk - 11 dagar sedan
Senaste mätningen bekräftar opinionsläget i Danmark
"Epinions senaste mätning bekräftar på viktiga punkter det opinionsläge oc..."
Enn Kokk - 11 dagar sedan
Visst blåste valvinden åt vänster
"" Mitt under en tydlig vänstervind när människors missnöje med den borger..."
Bengt Silfverstrand - 11 dagar sedan
Ducka eller ta ansvar för en ny färdriktning
"Vi är inte ett ensamt land uppe i norr som har stått emot förändringar ut..."
Roger Jönsson - 11 dagar sedan
Kalla inte Stefan Löfven svikare!
"Det handlar om 31 procent i riksdagsvalet, vilket blev det resultat som v..."
Björn Andersson - 11 dagar sedan
Nu måste vi får en regering som vill utveckla hela Sverige
"Sverige börjar i söder och slutar i norr Norrland är den nordligaste oc..."
Tord Oscarsson - 11 dagar sedan
Svår uppgift väntar för Moderaternai Det finns nu inte någon stark kandidat att efterträda Fredrik Reinfeldt
" Svår uppgift väntar för Moderaterna Publice..."
Tord Oscarsson - 11 dagar sedan
Sundsvallsbron öppnar 18 december
"Sundsvallsbron öppnar 18 december ..."
Tord Oscarsson - 12 dagar sedan
S enda chans till långsiktig överlevnad är att våga återskapa en tydlig skillnad mellan vänster och höger
"Daniel Suhonen skrev i Sydsvenskan inför valet den 14 september en fantas..."
Bo Widegren - 12 dagar sedan
Var fanns vänstervinden?.
"På DN-debatt skriver idag Enna Gerin och Daniel Suhonen från Katalys om a..."
Jan Andersson - 12 dagar sedan
En dag i en folkrörelse
"Idag hade jag den stora förmånen att besök Närlundadagen här i Helsingbor..."
Olas tankar - 12 dagar sedan
Det svenska missnöjet
"Många av dem som röstat på Sverigedemokraterna är varken rasister eller f..."
Mario Matteoni - 12 dagar sedan
Sverige står inför stora utmaningar - dags att sluta tjafsa
"Det hela över. Åtta år med alliansen vid makten är slut. Väljarna har sag..."
Roger Jönsson - 12 dagar sedan
Melodikrysset nummer 38 2014
"Vi ska ha stort familjekalas senare i dag – se nedan under nästa rubrik –..."
Enn Kokk - 12 dagar sedan
Beska sanningar om S-strategin
""S tappar när de fiskar i mitten." Den beska sanningen levereras av inge..."
Bengt Silfverstrand - 12 dagar sedan
Vänstervinden som ingen märkte
"I en debattartikeli dagens DN skriver Daniel Suhonen och Enna Gerin: ..."
Mario Matteoni - 12 dagar sedan
Socialdemokrater, ryck upp er!
"Idag lever vi ett samhälle som högern har skapat. Under åtta års tid så h..."
Björn Andersson - 12 dagar sedan
Ska Centerpartiet gå Maud Olofssons eller Olof Johanssons väg?
"Alla är nu medvetna om att vårt land står inför ett mera kritiskt vägval ..."
Bror Perjus - 12 dagar sedan
Förlust – då vänder Reinfeldt ryggen till
" Startsidan / Nyheter / Valåret 2014 2014-09-2..."
Tord Oscarsson - 12 dagar sedan
Se 2014 års Valresultat
" Valet 2014 Se 2014 års v..."
Tord Oscarsson - 12 dagar sedan
Får solidariteten stryka på foten?
""Som socialdemokrat står jag upp för människors lika värde. Det innebär f..."
Bengt Silfverstrand - 13 dagar sedan
Om val av riksdagens talman
"Susanne Eberstein Den 29 september kommer den nyvalda Riksdagen att gå ..."
Göran Johansson - 13 dagar sedan
Gör gärna upp med C o Fp, men var inte rädd för nyval! Vi är beredda att knacka dörr igen, från Smygehuk till Riksgränsen.
"Stefan Löfven, förhandla kraftfullt utifrån styrka och självkänsla. Du ha..."
Bror Perjus - 13 dagar sedan
Vem leder borgerligheten i ett nyval?
"Vissa borgerliga debattörer och politiker skramlar högljutt med vapnen nä..."
Peter Johansson - 13 dagar sedan
Det här med att bjuda till....
"     Just nu pågår samtal mellan Stefan Löfven och de olika borger..."
Monica Green - 13 dagar sedan
Stefan Löfven är långt ifrån naiv.
"I en enskild tidning kan finnas många olika uppfattningar. Så är det i la..."
Jan Andersson - 13 dagar sedan
Stefan Löfven vill ta ansvar
"Regeringsbildare Igår eftermiddag blev det till slut klart att talmanne..."
Göran Johansson - 13 dagar sedan
Ska vi ha betyg i förskolan?
"Det finns en oro över att det ska bli betyg i 4an och till och med i lägr..."
Björn Andersson - 14 dagar sedan
Kryssen är färdigräknade - tack för stödet
"Tack alla som röstat på socialdemokraterna i Skaraborg och tack för alla ..."
Monica Green - 14 dagar sedan
"Tre närstående av olika generationer – Birgitta , vår dotter Kerstin och ..."
Enn Kokk - 14 dagar sedan
Löfven får bilda ny regeringn -Nu vill se S-ledaren se blocköverskridande överenskommelser.
"Löfven får bilda ny regering S-ledaren höll pressträff med talmannen i r..."
Tord Oscarsson - 14 dagar sedan
Främlingsfientlighet är illa nog
"Varför inte ta kampen mot invandrarfientligheten i stället för mot etiket..."
Mario Matteoni - 14 dagar sedan
Kaoset på arbetsmarknaden borde gjorts till en huvudfråga i valrörelsen?
"Ett av två avgörande strategiska misstag i valrörelsen var, som jag skriv..."
Bror Perjus - 14 dagar sedan
Försvarar Centern budgetens integritet?
"Un der gårdagen fortsatte media diskussionerna om huruvida en regering le..."
Göran Johansson - 14 dagar sedan
Den sviktande välfärdsstaten är problemet
"En politiserande talman, dåliga förlorare på borgarsidan och mediala orgi..."
Bengt Silfverstrand - 14 dagar sedan
349 till ansvar dömda riksdagsledamöter
"Fyra dagar efter valet cirkulerar den politiska debatten kring den komman..."
Peter Johansson - 14 dagar sedan
I väntans tider
"Foto: Wikipedia Valet är över. Spelplanen för dom nästkommande fyra åren..."
Olas tankar - 14 dagar sedan
Talman Per Westerberg agerar tyvärr partipolitiskt.
"Talmannen har en central funktion när en ny regering ska utses. Uppdraget..."
Jan Andersson - 14 dagar sedan
Ska den nya regeringen använda sig av alliansens budgetförslag?
"Daniel Tarschys Daniel Tarschys, tidigare riksdagsledamot för Folkparti..."
Göran Johansson - 14 dagar sedan
Valresultat 2014
" ..."
Tord Oscarsson - 14 dagar sedan
S,V,Mp får 51,9 och Alliansen 32,6 iHärnösand
" Visa bildtext G..."
Tord Oscarsson - 14 dagar sedan
Demokratin i sjönöd - men käbbel bland de sju och SD vinner
"Det är egentligen en självklarhet - säger jag NEJ till mina ungar utan en..."
Jan Paimo - 14 dagar sedan
En obehagling sanning om Sverigedemokraterna!
"Det var inte endast Sverigedemokraterna som gick fram i valet 2014. Även ..."
Björn Andersson - 15 dagar sedan
Kjelle och Bettan i Indien
"Jag har tidigare med uppskattning – se ovan under Kulturspegeln, Barnkult..."
Enn Kokk - 15 dagar sedan
Vill inte väljare att det ska byggas bostäder?
"Det här blogginlägget skulle egentligen handla om att väljarna är mer pro..."
Joakim Jonsson - 15 dagar sedan
Maud Olofsson har spelat Monopol med Nuon
"Hör jag på radion att Totalförsvarets forskningsinstitut, FOIs generaldir..."
Monica Green - 15 dagar sedan
Valet gav inga lättolkade lösningar och lämnade massa frågor obesvarade!
"Ideologin omöjlig för att lösa ett läge utan klar majoritet? Bör väljarn..."
Bo Widegren - 15 dagar sedan
Nej, det kan man inte!
"Petter Lidbecks (text) och Lisen Adbåges (bild) " Kan man…? " (En bok för..."
Enn Kokk - 15 dagar sedan
Mätningarnas mätning 13 september 2014 S,V,Mp 170 ...
"Mätningarnas mätning 13 september 2014 S,V,Mp 170... ..."
Tord Oscarsson - 15 dagar sedan
IVO har inte fått alla handlingar, trots att de sista skickades 12 september- slutdatum är idag
"Onsdag den 17 september Det blev som jag trodde med de rekommende..."
Eva-Britt Dahlström - 15 dagar sedan
En liten stund med pannkakor eller med körsbärspaj
"Anna-Clara Tidholm är en mycket skicklig skapare av böcker för små barn. ..."
Enn Kokk - 15 dagar sedan
Natomedlemskap - till allt utom namnet
"Den avtalstext som den avgående regeringen lät offentliggöra igår är ska..."
Stefan Lindgren - 15 dagar sedan
Digital kommunikation lika viktig som fysiska vägar
"På IT-branschens terminsstart fick vi en diger genomgång av operatörernas..."
Monica Green - 15 dagar sedan
Tid för pragmatiker, inte fundamentalister.
"I min förra blogg kritiserade jag Maud Olofsson. Det är svårt att idag tr..."
Jan Andersson - 15 dagar sedan
Plötsligt avgick Fredrik Reinfeldt och avsatte hela sin regering. Helt i onödan!
"De tog aldrig politiken på allvar och därmed heller inte demokratin. Därf..."
Bror Perjus - 15 dagar sedan
Dags för politiskt ansvar. Alternativet förskräcker!
"Det är många som formulerar mycket om vad som nu behöver ske i Sverige. R..."
Lars G Linder - 15 dagar sedan
Kommer M att avstå röster från dumma lantisar?
" Anna Kinberg Batra, mest känd för sitt förakt mot "Lantisar", ska enlig..."
Peter Johansson - 15 dagar sedan
Hur samarbetsvilligt är Alliansen?
"Gardell tar det med ro Ett par av de rikstäckande tidningarna har sonde..."
Göran Johansson - 15 dagar sedan
Riksdag Landsting Kommun År 2014 i Västenorrlnds Län
"Redigerat av Tord Oscarsson Se 2014 års valresultat Upp..."
Tord Oscarsson - 15 dagar sedan
Migrationsexpeditionsminister kan väl inte avsättas hur korkat han än pratar?
"Tobias Billströms facebooksida 2014-09-15: ”En ny dag. Annorlunda. På väg..."
Bo Widegren - 15 dagar sedan
Tankar kring valutgången och om det som ska komma
"Jag är givetvis glad över att regeringen har välts över ända, framför all..."
Enn Kokk - 16 dagar sedan
Tack till S-kvinnor i Skövde
"   Stort tack för allt arbete ni utfört under valrörelsen. S-kvinnor i..."
Monica Green - 16 dagar sedan
Det pågår en eftervalsdebatt på arbetspatserna!
"Det pågår en eftervalsdebatt. Det handlar om en ekonomi och debatt om inv..."
Björn Andersson - 16 dagar sedan
Mätningarnas mätning 13 september 2014 S,V,Mp 170 mandat Alliansen 143 Sd 36
"Redigerat av Tord Oscarsson ..."
Tord Oscarsson - 16 dagar sedan
Militanta Maud är numera tillgänglig för media.
"Maud Olofsson var under en tid inte tillgänglig för varken KU eller för m..."
Jan Andersson - 16 dagar sedan
Norrland måste också få chans att utvecklas. Den nya regeringen är inriktad på det.
"Jag har noga följt 2014 års val. Det slutade med rödgrön seger på många n..."
Tord Oscarsson - 16 dagar sedan
TV4/Novus Väljarbarometer 13 september 2014: De rödgröna leder
"TV4/Novus Väljarbarometer 13 september 2014: Blockskillnad 5.3 % 13 ..."
Tord Oscarsson - 16 dagar sedan
DN/Ipsos: Rödgröna partierna leder klart
" DN/Ipsos: Rödgröna partierna leder klart Redigerat av Tord Oscar..."
Tord Oscarsson - 16 dagar sedan
Reinfeldt meddelar sin avgång i känslosamt tal
" Reinfeldt meddelar sin avgång i känslosamt tal ..."
Tord Oscarsson - 16 dagar sedan
Finlands Gröna lämnar regeringen på torsdag
"Gröna förbundet ( Vihreä Liitto ) lämnar med största sannolikhet regering..."
Enn Kokk - 16 dagar sedan
Vill borgarna verkligen ha nyval?
"Valrörelsen är över oss och resultatet är ovant för Sverige. Vi har levt ..."
Peter Johansson - 16 dagar sedan
Valets vedermödor och vänsterskräck
"Svenska folket har röstat för en förändring. Det var Stefan Löfvens entyd..."
Bengt Silfverstrand - 16 dagar sedan
Socialdemokratiet på hyggligt hög nivå i ny dansk mätning
"I Voxmeters senaste mätning ligger Socialdemokratiet inte bara tvåa utan ..."
Enn Kokk - 16 dagar sedan
Sverigedemokraterna utestänger media
"Under valdagen blev det bekant att Sverigedemokraterna (SD) valt att utes..."
Göran Johansson - 16 dagar sedan
Kammarorkestern med Ellen Nisbeth som solist på viola
"Höstsäsongens första konsert med Uppsala kammarorkester , som vanligt und..."
Enn Kokk - 16 dagar sedan
Kammarorkestern med Ellen Nisbeth som solist på viola
"Höstsäsongens första konsert med Uppsala kammarorkester , som vanligt und..."
Enn Kokk - 16 dagar sedan
Politiken kommer att ligga i mittfåran.
"Det var inte alls överraskande att Stefan Löfven inte vill ha med vänster..."
Jan Andersson - 16 dagar sedan
Allt tyder på maktskifte
" Allt tyder på maktskifte Publicerad 2014-09-12 19:30 ..."
Tord Oscarsson - 16 dagar sedan
Ny opinionsmätning: Ökat gap mellan blocken
" ..."
Tord Oscarsson - 16 dagar sedan
Martin Mobergs betraktelser har flyttat fr o m idag...
"Det har under de senaste dryga sex åren blivit dagligen återkommande blog..."
Martin Moberg - 16 dagar sedan
S,V,Mp 41,7 Alliansen 39,3 Sd 12,9
"S 30,2 V 5,7 Mp 5,8 = 41,7 M 23,2 Fp 5,4 C 61 Kd 4,6 = 39,3 Sd 12,9 T..."
Tord Oscarsson - 16 dagar sedan
Den nya bilden av Sverige och väljarna
" Den nya bilden av Sverige och väljarna ..."
Tord Oscarsson - 16 dagar sedan
Alla valdistrikt (5837) i Sverige är färdigräknade. 010203040010203040
" Visar resultat för land: Sverige ..."
Tord Oscarsson - 16 dagar sedan
Är det bara jag som tycker det är lätt!
"Idag kommer Stefan Löfven att få talmannens uppdrag att bilda regering. D..."
Joakim Jonsson - 16 dagar sedan
"Besviken Stefan Löfven har startat diskussionerna om att bilda en reger..."
Göran Johansson - 16 dagar sedan
Här rasar moderaterna mest På den skånska slätten tappade Fredrik Reinfeldt 14 %
"Här rasar moderaterna mest Publicerad 2014-09-15 17:10 ..."
Tord Oscarsson - 16 dagar sedan
Härnösand Fortsatt rödgrönt samarbete
"Fortsatt rödgrönt samarbete ..."
Tord Oscarsson - 16 dagar sedan
Moderaterna ett parti i kris - När topptrion Reinfeldt, Bildt och Borg försvinner uppstår ett vakuum som måste fyllas.
"Moderaterna ett parti i kris I ett slag försvinner Moderaternas topptr..."
Tord Oscarsson - 16 dagar sedan
Nu kommer svekdebatten från höger och vänster!
"Idag går Vänsterpartiets Jonas Sjöstedt och gråter ut i Agenda !Socialdem..."
Björn Andersson - 17 dagar sedan
Grattis S i Härnösand!
"Grattis S i Härnösand till ett nytt mandat i kommunfullmäktige och till e..."
Sig-Britt Ahl - 17 dagar sedan
Har någon missat att se Die Welle?
"I så fall kan jag verkligen rekommendera den. Den borde vara självskriven..."
Mats Andersson - 17 dagar sedan
#val2014 - politik för jämlikhet bra för sjukvården...
"(landstingsvalet i Blekinge med fortsatt rödgrön majoritet) I valsammanh..."
Martin Moberg - 17 dagar sedan
Löfven: ”Det ska vara flera partier i regeringen”
"Löfven: ”Det ska vara flera partier i regeringen” Löfven stänger inga ..."
Tord Oscarsson - 17 dagar sedan
Den gråtande sverigedemokraten
"Hon hade kanske varit en vända på krogen, och klockan var sent. Vi skulle..."
Sjölander - 17 dagar sedan
Partiledningens två allvarliga och avgörande misstag i valrörelsen!
"Den socialdemokratiska partiledningen gjorde två allvarliga strategiska m..."
Bror Perjus - 17 dagar sedan
#val2014 - den sociala infrastrukturens betydelse...
"(preliminärt valresultat kommunalvalet Ronneby 14/9 -14) Jag var under g..."
Martin Moberg - 17 dagar sedan
De lämnar allianskeppet
"    Under valnatten meddelade Fredrik Reinfeldt sin avgång som par..."
Monica Green - 17 dagar sedan
#val2014 - det vart en delvis seger....
"Samlar tankarna efter gårdagens val , som på många sätt lämnar en hel del..."
Martin Moberg - 17 dagar sedan
SD skördade Reinfeldts draksådd
"Med draksådd menas utspridande av fördärvbringande åsikter eller läror, e..."
Peter Johansson - 17 dagar sedan
När morgonen gick sönder.
"- Du ser, du ser, säger han belåtet till mig. Det här är vad som händer n..."
Calle Fridén - 17 dagar sedan
Stor glädje med lite smolk i bägaren.
"Stefan Löfven kommer att få uppdraget att bilda en ny regering. Det är sl..."
Jan Andersson - 17 dagar sedan
M kastade skit på Malmö och fick ett rungande svar – Malmöstyle #val2014
"Jag kommer att skriva ett antal valanalysposter de kommande veckorna. Med..."
Peter Johansson - 17 dagar sedan
Lövfen är rätt man
"Valresultatet kommer att så småningom påverka och förändra samtliga parti..."
Mario Matteoni - 17 dagar sedan
Stefan Löfven blir statsminister
"Stefan Löfven När jag skriver detta inlägg tyder allt på att alliansens..."
Göran Johansson - 17 dagar sedan
Blockpolitiken är död, länge leve demokratin och politiken
"När man surfar omkring på olika bloggar och läser tidningar är det flera ..."
Joakim Jonsson - 17 dagar sedan
Reinfeldt avgår som statsminister och moderatledare. Löfven är redo att bilda ny regering och sträcker ut handen till alla partier utom SD
"Efter valfiaskot kom bomben. Klockan 23.18 meddelade Fredrik Reinfeldt at..."
Tord Oscarsson - 17 dagar sedan
Socialdemokraterna vann valet!!
"Socialdemokraterna vann valet 2014. Det visar vid skrivandes stund. Fredr..."
Björn Andersson - 17 dagar sedan
Min favoritregering vann!
"För över 1,5 år sedan skrev jag på den här bloggen att den bästa regering..."
Joakim Jonsson - 18 dagar sedan
2014 års val i Härnösand. Nuvarande kommunledning får 58.5 %
"M 12,0 C 17,1 Fp 2,4 Kd 2,4= 33.9 S 43,5 V 7,5 Mp 7.5 = 58,5 Sd 6,9 Re..."
Tord Oscarsson - 18 dagar sedan
Följ 2014 års valresultat S,V.;Mp 44,0 % Alliansen 38,4
"2014 Följ 2014 års valresultat Uppdaterad i dag 20:5..."
Tord Oscarsson - 18 dagar sedan
Alliansen 39,7 Rödgröna 44,8
Tord Oscarsson - 18 dagar sedan
Välslickade Måns, Bill, Bull och stygga Annie
"Elaka Måns sa: Stygga Annie gjorde precis som vi sa åt henne och bröt mot..."
Bo Widegren - 18 dagar sedan
Förnedringsteve - grejen för TV4
"Meddelande Eftersom vi är ett privat bolag så har vi inte så fasta regle..."
Bo Widegren - 18 dagar sedan
"Klockan har nu nyss passerat 19.00 på kvällen, valdagen, den 14 september..."
Bernt Ortner - 18 dagar sedan
"Tack alla valarbetare i Skövde, Skaraborg och Sverige som kämpat ända in ..."
Monica Green - 18 dagar sedan
Några timmar före resultatet: Lugn Fi kommer in i Riksdagen!
"Fi måste ta sig över spärren! Det är bara några timmar kvar och dags för..."
Bo Widegren - 18 dagar sedan
Som alltid har jag röstat på Socialdemokraterna
"Jag blev i mycket unga år socialdemokrat, och när jag fick rösträtt, röst..."
Enn Kokk - 18 dagar sedan
Allt tyder på maktskifte. S,V,Mp 46,4 Alliansewn 39,5 Valets stora förlorare ser ut att bli Moderaterna.
" Allt tyder på maktskifte Publicerad 2014-09-12 19:30 ..."
Tord Oscarsson - 18 dagar sedan
Valet 2014, en sammanfattning del 2.
"Idag har jag stått två timmar utanför Myrsjöskolan i Orminge. Det som upp..."
Björn Andersson - 18 dagar sedan
Arboga öl och valet
"Jag har redan utfört min medborgerliga plikt genom att den här gången för..."
Bengt Silfverstrand - 18 dagar sedan
I dag är det demokratins högtidsdag
"Nu har jag arbetat färdigt i valrörelsen. Givit järnet i 4 veckor, föruto..."
Britta Sethson - 18 dagar sedan
#val2014: Val och "val", dags ta ställning
"(apropå detta med valfrihet, så här på valdagen - illustr: Robert Nyberg)..."
Martin Moberg - 18 dagar sedan
Valet 2014, en sammanfattning del 1.
" Igår ägnade hela dagen åt valrörelsen. Jag har stått i Orminge ..."
Björn Andersson - 18 dagar sedan
Den längsta dagen.
"När jag var barn talades det om långfredagen som årets längsta dag efters..."
Jan Andersson - 18 dagar sedan
Därför ska du rösta i valet idag!
"Sverige är ett demokratiskt land där vi har möjligheten att påverka och f..."
Björn Andersson - 18 dagar sedan
Riksadagsvalet 13 september 2014 S,V,Mp166 mandast . Alliansen 146. Sd 47
"R iksdagsvalet Publicerad 13 september 2014 Uppdaterad 13 sept..."
Tord Oscarsson - 18 dagar sedan
SONU-genomsnitt* 13 sep S,V,Mp 175 mandat Alliansen 135 SD 39
" SONU-genomsnitt* 13 sep..."
Tord Oscarsson - 18 dagar sedan
Alliansen 40,1 SVMP 51,1 S,V,Mp 195 mandat Alliansen 112 Sd 42
"T Både Centerpartiet och Kristdemokraterna är åter under 4 procentspärre..."
Tord Oscarsson - 18 dagar sedan
Det kan inte uttryckas på ett bättre sätt
"Kommentarer överflödiga. Rösta rätt… Mats Och var stolt över Sv..."
Mats Andersson - 19 dagar sedan
Starkt jobbat SSU i Nässjö
"Ännu en natt med öppen valstuga. Det ser ut som om vi är det enda parti..."
Mats Andersson - 19 dagar sedan
Nytt ledarskap för Skåne
"Snart går skåningarna till val för att bestämma vem som ska leda den skån..."
Sjukvårdsvalet - 19 dagar sedan
Vi vill satsa på Ystad lasarett
"Ystad lasarett har en viktig roll att spela för de boende i Ystad med omn..."
Sjukvårdsvalet - 19 dagar sedan
Man ska ju inte bli sjuk och inte arbetslös
" Man går kanske inte och tänker på vad som händer i Sverige. Vad skatte..."
Gällivareortens Socialdemokratiska Arbetarekommun - 19 dagar sedan
Ett dygn kvar – På Söndag byter vi!
"Vilken valrörelse! Jag tror jag genomfört mer än 1500 personliga samtal m..."
Chatarina Holmberg - 19 dagar sedan
Mitt sista blogginlägg
"I över fyra år har jag skrivit inlägg på den här bloggen i syfte att förs..."
Joakim Jonsson - 19 dagar sedan
När aktivismen åkte till sommarstugan
"Egentligen gillar jag valrörelser. Ja, inte fördumningen eller förenkling..."
Calle Fridén - 19 dagar sedan
Arbetsmiljön för kvinnor blir sämre och sämre
"Det har skett en stor förändring bara sedan 2011. Jag tycker att arbetsli..."
Lennart Holmlund - 19 dagar sedan
S hack i häl på Venstre i ny dansk mätning. Dansk Folkeparti nere på tredje plats
"De danska opinionsundersökningarna fortsätter att ge skiftande resultat. ..."
Enn Kokk - 19 dagar sedan
Arbeiderpartiet större än Høyre i Oslo
"Den opinionsmätning Sentio har gjort för Klassekampen , i dag för övrigt ..."
Enn Kokk - 19 dagar sedan
Att inte ha råd med en pulka till sin dotter...
"(#utförsäkrad i Reinfeldts Sverige , inte enstaka fall...) För en stund ..."
Martin Moberg - 19 dagar sedan
Aftonbladet träffade Löfven på tåget till Göteborg. Han delade kupé med vallokomotivet Margot Wallström,
"Aftonbladet träffade Löfven på tåget till Göteborg. Han delade kupé med..."
Tord Oscarsson - 19 dagar sedan
Du avgör Sveriges framtid
"Ett dygn kvar tills din röst räknas Imorgon är valdagen här och din röst ..."
Monica Green - 19 dagar sedan
Skövde Stadslopp
"  En härlig dag med septembersol och mycket folk i farten. Rekordmång..."
Monica Green - 19 dagar sedan
#val2014: dags för en kopp stark kaffe med extra bönor
"Igår kväll var det dags för SVT:s traditionella slutdebatt mellan riksdag..."
Martin Moberg - 19 dagar sedan
Valfläsk och vankelmod
"En märklig valrörelse lider mot sitt slut. Den ena debatten avlöser den a..."
Bengt Silfverstrand - 19 dagar sedan
Melodikrysset nummer 37 2014
"I dag, dagen före valet, aktade sig Anders Eldeman noga för att spela mus..."
Enn Kokk - 19 dagar sedan
Fredrik Reinfeldt sista debatt
"Ikväll är det statsministerduell mellan Stefan Löfven och Fredrik Reinfel..."
Joakim Jonsson - 19 dagar sedan
Fler lärare och mindre klasser
" Om Socialdemokraterna tar regeringsmakten efter söndagens val kommer vi ..."
Bloggande Socialdemokrater i Halland - 19 dagar sedan
Feministiskt initiativ, Fi, kan komma in och skapa en vänstermajoritet
"Enligt såväl DNs som SvDs opinionsmätningar idag är Sverigedemokraterna v..."
Bror Perjus - 19 dagar sedan

Göteborg Norrbotten Västerbotten Jämtland Västernorrland Gävleborg Dalarna Värmland Örebro län Västmanland Uppsala län Sörmland Gotland Kalmar län Blekinge Skåne Kronoberg Jönköpings län Halland Östergötland Stockholms län/Arbetarekommun Skaraborg Bohuslän Norra  lvsborg Södra  lvsborg Starta en egen hemsida och blogg