Varför skall vi ha en uppdelad skola?

Finns det någonting som visar, att vårt lands utbildning blir bättre med en uppdelning av skolan? Det som framförts som avgörande delar är - valfriheten? För föräldrar har detta blivit en ”symbol” för att kunna välja (även om det blir sämre!). Den gemensamma skolan betraktas generellt som ”sämre”, även om detta inte är förhållandet - bättre utbildning? På vilket sätt, måste man fråga sig? Det finns ingenting som visat sig vara bättre i den uppdelade, fria skolan. Det framförs att man bä...

» Läs hela inlägget

Postat av: C G Carlsson - 20 januari 19:00, 2012

Ämnen: usapolitikprivatiseringsverigeutbildningskolanfriskolorsvtsocialdemokratinlärarnas riksförbundriskkapitalbolaglärarfacketfriskolebolaggpskatteparadissegregeringpysslingenvalfrihetenmetta fjelknerbaggiumfriskolekoncerneracademediasr ekotuppdelningenden gemensamma skolanden fria skolanatheneskolanguernsey
Senaste blogginlägg
Hur faen kan han vinna - han är ju homosexuell!?
"Hur många knullar enbart för att få barn? Alexander Ekman nämner rubrik..."
Bo Widegren - 6 minuter sedan
Augusti 2015
"Augusti har nätt och jämnt börjat men nu verkar det som - nu när så många..."
Katarina Bredberg - 40 minuter sedan
Sommar i P1 med Alexander Ekman
"Först tycker jag att Alexander Ekmans Sommar inte har någon röd tråd. Me..."
Enn Kokk - 1 timmar sedan
Terrorresenärer går fria
"Foto: Det är mycket tal om terrorresor just nu. Diskuss..."
Olas tankar - 2 timmar sedan
Obama tar kampen mot kol.
"Bra intiativ av Obama men varför inte tidigare Läs mera här Usa Obam..."
Lennart Holmlund - 3 timmar sedan
Öka kunskapskraven i den svenska skolan!
"Dagens Anders, Dagens inlägg handlar på nytt om den svenska skolan och mi..."
Anders Forss - 5 timmar sedan
Tyvärr är Danielssons ord fortfarande aktuella
"I år hade jag tyvärr inte möjlighet att titta på den traditionella Tage D..."
Joakim Jonsson - 6 timmar sedan
Danmark annonserar för att få färre som söker asyl
"Danmark har länge haft en främlingsfientlig inställning Det här tar ändå ..."
Lennart Holmlund - 9 timmar sedan
USA visar vägen i klimatfrågan
"Vi är många som under flera år har väntat på att världens största ekonomi..."
Joakim Jonsson - 20 timmar sedan
Produktion och orderingång driver uppgången
"Idag kom ytterligare statistik som visar att det går bra för Sverige och ..."
Joakim Jonsson - 20 timmar sedan
Sverigedemokraternas tunnelbanekampanj är ett lågvattenmärke!
"Rent språkmässigt så är engelskan i tunnelbanestationerna väldigt låg, på..."
Björn Andersson - 21 timmar sedan
"Aftonbladet Kryss & Quiz har gjort dumheten att göra sig av med flera av ..."
Enn Kokk - 23 timmar sedan
Sommar i P1 med Åsa Jinder
"Åsa Jinders Sommar blev ganska personligt, till exempel genom berättelse..."
Enn Kokk - 1 dagar sedan
Kostnaden för hyrpersonal i vården skenar okontrollerat.
"Dagens Anders, Dagens andra inlägg handlar om en av mina hjärtefrågor - s..."
Anders Forss - 1 dagar sedan
Trafikverket har stora problem hela tiden
"Någt måste göras och det är inte bara räls som hotar att spricka. Läs mer..."
Lennart Holmlund - 1 dagar sedan
Arbetslinjen har förstört Sveriges sociala trygghetssystem - Landets socialtjänster i kris!
"Dagens Anders, Dagens inlägg handlar om hur Alliansens arbetslinje slitit..."
Anders Forss - 1 dagar sedan
Avhoppare från IS avslöjar hur barbarisk IS är
"läs mera på denna länk Is Jihadister Islamistiska staten Barbarer ..."
Lennart Holmlund - 1 dagar sedan
Studier är vägen till jobb
"    Sveriges unga behöver framtidstro, självförtroende och förutsä..."
Monica Green - 1 dagar sedan
Nysättrahemmet - Norrtälje
"Jag fick en skrift i brevlådan och den kom från människor som har starka ..."
Jan Paimo - 2 dagar sedan
Stockholm Pride 2015 blev en stor framgång!
"Årets Stockholm Pridetåg blev en stor succé! Hela 40 fler ekipage var det..."
Björn Andersson - 2 dagar sedan
De som rånar folk i staden ska åka fast och buras in
"Jag brukar kalla att deras bostad är enkelrum med Järngardiner. Här ska d..."
Lennart Holmlund - 2 dagar sedan
Korta meningar
"Mulla Omar och hans fru Ulla Omar. * * * En pryddemonstration är av n..."
Enn Kokk - 2 dagar sedan
Sommar i P1 med Markus Näslund
"Markus Näslunds Sommar -prat i dag var knappast något för lyssnare av mi..."
Enn Kokk - 2 dagar sedan
"- Du har brutit löftet du gav mej. – Såja… Gråt inte, du ska få ett nyt..."
Enn Kokk - 2 dagar sedan
Bojkotta de som finansierar terrorism
"Det är klart att någon bidrar med pengar till terrorism. Eller hur Te..."
Lennart Holmlund - 2 dagar sedan
Sommar i P1 med Bea Åkerlund
"Jag måste tillstå att min kunskap om Bea Åkerlund före hennes Sommar -pro..."
Enn Kokk - 3 dagar sedan
Faran för Grekland är långt ifrån över
"De beslut som Greklands regering tog räcker nog inte och IMF kräver nedsk..."
Lennart Holmlund - 3 dagar sedan
Häftigt att betala skatt
"Att Mona Sahlin tyckte det var häftigt att betala skatt, då det begav sig..."
Bengt Silfverstrand - 3 dagar sedan
Melodikrysset nummer 31 2015
"Till sommarens fröjder för oss pensionärer hör att få besök av barn och b..."
Enn Kokk - 3 dagar sedan
1 augusti 2015 är en mycket speciell dag för mig.
"Dagens Anders, Dagens inlägg är mycket kort, och är kort och gott ett GRA..."
Anders Forss - 3 dagar sedan
"Idag avslutas Stockholms Pride med en hejdunerlig parad. Pride har vuxit ..."
Monica Green - 3 dagar sedan
Pride är en märklig företeelse
"Nu är jag trött på att alla har fördomsfulla människor. Varför tror de al..."
Björn Andersson - 3 dagar sedan
Stjärnkusken var ett bra program
"Hästen är ett gudomligt djur att umgås med och roligt att spela på. Läs m..."
Lennart Holmlund - 3 dagar sedan
Sommar i P1 med Stig Grybe
"Stig Grybe är 87 år, och det är strongt av honom att i den åldern och med..."
Enn Kokk - 4 dagar sedan
Sverigedemokraternas skandalbyrå är oändligt full!
"Varje dag så kommer nya skandaler från Sverigedemokraterna. Någon fundera..."
Björn Andersson - 4 dagar sedan
Ska vi lägga ner svenskt jordbruk och svensk livsmedelsproduktion?
"Dagens Anders, Dagens inlägg handlar om den hopplösa situation Sveriges m..."
Anders Forss - 4 dagar sedan
Lite folkvett och sunt förnuft skadar inte
"Blir förvånad över hur folk beter sig. Läs resten här Norrtåg Botnia..."
Lennart Holmlund - 4 dagar sedan
Bekräftelse att dysterkvistarna fick fel, men också bekräftelse att S-målet blir en utmaning
"Som jag har skrivit om på denna blogg många gånger tycker jag att det är ..."
Joakim Jonsson - 5 dagar sedan
Jag ska minsann inte våldtas stup i kvarten
"Häromdagen vidarebefordrade jag en grej på twitter. Ingen särskild grej, ..."
Calle Fridén - 5 dagar sedan
IMF nobbar Grekland - deltar inte i tredje stödprogrammet.
"Dagens Anders, Dagens andra inlägg lyfter på nytt Greklandsfrågan då det ..."
Anders Forss - 5 dagar sedan
Sommar i P1 med Maxida Märak
"Det är högst rimligt att också någon same förekommer bland sommarvärdarna..."
Enn Kokk - 5 dagar sedan
Skattetjuvar stjäl från svenska folket
"Den socialdemokratiske ministern Gustav Möllers uttalande ”Varje förslö..."
Mario Matteoni - 5 dagar sedan
Köp av villa 2015 ett större berg att bestiga än ett villaköp 1969 - Inflationen frånräknad.
"Dagens Anders, Dagens inlägg visar genom användandet av ett exempel som b..."
Anders Forss - 5 dagar sedan
Arbetslösheten sjunker och arbetskraftsbristen når nya höjder!
"I slutet på juni var 354 000 personer, 16-64 år, inskrivna arbetslösa (öp..."
Björn Andersson - 5 dagar sedan
Sverigedemokraternas Pridedemonstration misslyckades.
"Avpixlat och Sverigedemokraten Jan Sjunnesson genomförde sin egen Pridede..."
Björn Andersson - 5 dagar sedan
Finlands riksdag har fattat beslut om nytt kärnkraftsverket
"Så är det och jag tror det vore bra om tiggarna åker hem och ser till att..."
Lennart Holmlund - 5 dagar sedan
Dags att även vi konsumenter inser att det går bra för Sverige!
"Idag kom statistik, som förstärker bilden att det går bra för Sverige. Bo..."
Joakim Jonsson - 6 dagar sedan
Invandringens betydelse och SD:s verkliga ansikte
"I dagarna har vi fått nya belägg för invandringens faktiska betydelse för..."
Bengt Silfverstrand - 6 dagar sedan
Sommar i P1 med Kristina Sandberg
"Sundsvall är min gamla skolstad, men eftersom jag 1971, det år Kristina S..."
Enn Kokk - 6 dagar sedan
Är det svårt att vara liberal med mänskligt ansikte?
"Alice Teodorescu har arbetat på Svenskt Näringsliv . Inte för at..."
Mario Matteoni - 6 dagar sedan
Har Sverige blivit ett bättre land?
"Dagens Anders, I dagens inlägg ställer jag den lika relevanta som obekväm..."
Anders Forss - 6 dagar sedan
Fler invandrare får jobb!
"Noterar i en TT-artikel publicerad i dagens Corren att Arbetsförmedlingen..."
Joakim Jonsson - 6 dagar sedan
Märkligt uttalande av Putin när VM kvalet i fotboll lottades
"Vad är motivet för Putin när han tycker att Blatter ska få ett Nobelpris...."
Lennart Holmlund - 6 dagar sedan
Sommar i P1 med Hans Mosesson
"Hans Mossesson är säkert för de flesta känd som ICA-Stig – också jag har ..."
Enn Kokk - 7 dagar sedan
Juli 2015
"Mer eller mindre är juli månad 2015 snart slut och vilken månad sedan. ..."
Katarina Bredberg - 7 dagar sedan
Manifestation i Umeå mot mäns våld mot kvinnor
"Idag samma dag hölls en manifesten not våldet mot kvinnor på Rådhustorget..."
Lennart Holmlund - 7 dagar sedan
EU en bläckfisk som vill växa....
"Under pågående Greklandsdrama missade medierna att informera om en ny rap..."
Bengt Silfverstrand - 7 dagar sedan
Rätten till en bostad är en fundamental rättighet i ett DEMOKRATISKT samhälle.
"Dagens Anders, Dagens inlägg handlar om något så grundläggande som rätten..."
Anders Forss - 7 dagar sedan
En bottenskyla ur pilsnerflaskan
"Jag har klunk för klunk svalt det som fanns i Pilsnerboxen 2 , i vissa st..."
Enn Kokk - 7 dagar sedan
Nu minskar arbetslösheten, samtidigt som sysselsättningen ökar!
"Jag har tidigare fått kritik för att jag är lite för optimistisk om svens..."
Joakim Jonsson - 7 dagar sedan
Fler än hälften av alla unga saknar egen bostad
"Bostadsbristen blir allt värre för unga. Aldrig sedan Hyresgästföreningen..."
Joakim Jonsson - 7 dagar sedan
Finns det intelligent liv i universum?
"Nasa har nyligen funnit en jordliknande planet, Kepler 452b , 1400 ljuså..."
Mario Matteoni - 7 dagar sedan
SVT,,s Nyhetsbevakning ????
"Läs vad jag tycker här Nyheter Hagamannen Regeringen Arbeslöshets..."
Lennart Holmlund - 7 dagar sedan
Tiden och synen på samhället förändras inte av sig själv!
"Flera som skriver inlägg vill lägga på mig någon form av politiker epitet..."
Björn Andersson - 7 dagar sedan
De ökande sjuktalen är resultatet av det dåliga samhället.
"Dagens Anders, Dagens inlägg handlar om det dåliga samhället. I dagens ek..."
Anders Forss - 8 dagar sedan
Sommar i P1 med Alice Teodorescu
"Alice Teodorescu är ny chef för Göteborgs-Postens ledar- och kulturredakt..."
Enn Kokk - 8 dagar sedan
Socialedemokraterna mångfaldens framtidsparti?
" Denna vecka är det Pridevecka i Sverige och i huvudstaden. Dett..."
Björn Andersson - 8 dagar sedan
Glöm Greklandskris och börsfall i Kina. Det verkliga hotet för stabil ekonomisk tillväxt kommer från USA
"Som nästan alla politisk intresserade följer jag nu med stort intresse pr..."
Joakim Jonsson - 8 dagar sedan
Är det en bra eller dålig nyhet att vi lånar mer pengar?
"För några år sedan koncentrera sig Riksbanken mycket på att priserna på b..."
Joakim Jonsson - 8 dagar sedan
Bygget av det goda samhället.
"Dagens Anders, Dagens inlägg beskriver varför vi aldrig ska ge upp drömme..."
Anders Forss - 8 dagar sedan
Lite om inkomst och kostnadsutjämningen och behovet av en kommunreform
"jag tycker du ska ta dig tid att läsa denna blogg och fundera. Bloggen fi..."
Lennart Holmlund - 8 dagar sedan
Full sysselsättning en hörnsten i Socialdemokratisk politik.
"Dagens Anders, Hela dagens inlägg ägnas åt att skapa förståelse varför ka..."
Anders Forss - 9 dagar sedan
Monsieur Hulot i plasthelvetet
"Jag anser fortfarande, att Jacques Tatis (1908-1982) " Semestersabotören ..."
Enn Kokk - 9 dagar sedan
Sommar i P1 med Olle Jönsson
"Självfallet känner jag till Olle Jönsson och hans dansband Lasse Stefanz ..."
Enn Kokk - 9 dagar sedan
Nu blir det höjda pensioner och ordning på taximarknaden?
"Det finns olika skalor för hur civiliserat ett samhälle är. Tillgången ti..."
Joakim Jonsson - 9 dagar sedan
Dags att bygga ett nytt sagoland!
"Med risk för att vara sist på bollen, har jag nu läst vänsterpartisten Am..."
Joakim Jonsson - 9 dagar sedan
Ideologin och statistiska skäl att släppa alliansspöket
" Normal 0 21 ..."
Joakim Jonsson - 9 dagar sedan
"Jag läste igår med förvåning en artikel på ledarsidan i GP av psykiatrike..."
Jan-Åke Simonsson - 9 dagar sedan
Sluta missbruka ordet feminism!
"Ordet Feminism kastas dagligen ut av allt från kändisar till politiker. Ä..."
Björn Andersson - 9 dagar sedan
Sverige behöver flera Zara Larsson
"Idag var det dags för årets yngsta sommarpratare, men kanske också den vi..."
Joakim Jonsson - 10 dagar sedan
Bostäder och bredband..
"är två ämnen som jag skriver om i Vi i Sollentuna den här veckan, se http..."
Joakim Jonsson - 10 dagar sedan
Sommar i P1 med Zara Larsson
"Eftersom talangtävlingar i TV4 ligger utanför det jag skulle komma på idé..."
Enn Kokk - 10 dagar sedan
Kapitalism + liberalism = Nyliberalism!
"Dagens Anders, I dagens inlägg förtydligar jag de värdegrunder jag lägger..."
Anders Forss - 10 dagar sedan
För mycket knark på musikfestival
"läs mera här Musikfestival Knark Polis..."
Lennart Holmlund - 10 dagar sedan
Lyssna på Sundström, Löfven!
"Under den uppfordrande rubriken "Utöka DÖ för att stoppa nedisningen i ek..."
Bengt Silfverstrand - 10 dagar sedan
Melodikrysset nummer 30 2015
"I dag innehöll Melodikrysset, med ett undantag, hörvärd musik. Undantaget..."
Enn Kokk - 10 dagar sedan
De som är och krigar med terrororganisationen IS ska straffas
"Tre män i Göteborg häktade och misstänkta för mord med IS. Läs mera på VK..."
Lennart Holmlund - 10 dagar sedan
Obamafeber när presidenten besöker Kenya
"Snygga till det som syns! Man rapporterar om obamafeber i Kenya inför O..."
Bo Widegren - 11 dagar sedan
Sommar i P1 med Syster Karin (Karin Johansson)
"Syster Karin , Karin Johansson , är allmänt känd för de insatser hon och ..."
Enn Kokk - 11 dagar sedan
Sommar i P1 med Syster Karin (Karin Johansson)
"Syster Karin , Karin Johansson , är allmänt känd för de insatser hon och ..."
Enn Kokk - 11 dagar sedan
Hög tid att Europas Socialdemokrater sluter leden och kraftsamlar mot nyliberalismen.
"Dagens Anders, Dagens inlägg handlar om vikten av att alla Europas Social..."
Anders Forss - 11 dagar sedan
Blir det mindre glest?
"Om man slår samman två glesbygdskommuner så blir det ju inte mindre g..."
Sig-Britt Ahl - 11 dagar sedan
Widar Anderssons tokhyllning av en Socialdemokratisk illusion!
"Det är inte endast sorgligt, utan känns sorgligt när jag läser Widar Ande..."
Björn Andersson - 11 dagar sedan
IS måste förgöras med vapenmakt.
"Deras härjningar har fått pågå alldeles för länge även om det nu sätts in..."
Lennart Holmlund - 11 dagar sedan
Sommar i P1 med Arkan Asaad
"Arkan Asaads Sommar i dag var ett av de mest genomarbetade och hörvärda ..."
Enn Kokk - 12 dagar sedan
Till grillen?
"På Dagens Nyheters Namn och Nytt återges följande annons: " Oxhjärta 59..."
Enn Kokk - 12 dagar sedan
Rapport om mediebilden av muslimer
"Det har kommit frågor om en forskningsrapport jag har skrivit. Jag har fö..."
Marta Axner - 12 dagar sedan
Utredning om en ny kommunreform ett bra initiativ.
"Dagens Anders, Dagens inlägg handlar om det framsynta initiativ vår Socia..."
Anders Forss - 12 dagar sedan
En majoritet av danskarna tror att nya S-ledaren Mette Frederiksen har chans att bli statsminister i Danmark vid nästa val
"När det stod klart att Danmark efter valet skulle få en ny, borgerlig reg..."
Enn Kokk - 13 dagar sedan
Sommar i P1 med Gunilla Röör
"Skådespelerskan Gunilla Röör är välkänd framför allt genom TV-serien Lorr..."
Enn Kokk - 13 dagar sedan
Oron är bekräftad!
"Det är värre än jag trodde! Hatet finns i samhället! Och det växer tydlig..."
C G Carlsson - 13 dagar sedan
Arbetskraftsinvandring och EU-migranter.
"Dagens Anders, I dagens inlägg redovisar jag min syn på arbetskraftinvand..."
Anders Forss - 13 dagar sedan
Gör nåt antirasistiskt själva då, lata borgare
"Under en period har jag nu blivit mer och mer irriterad på diverse borger..."
Calle Fridén - 13 dagar sedan
Sverigedemokraternas Pridedemonstration luktar unket!
"Idag blev jag inbjuden av Zeliha Dagli att deltaga i Pride Järva. En Prid..."
Björn Andersson - 13 dagar sedan
Det finns dagar och händelser som man aldrig glömmer, men bortom hatet växer hoppet fram!
"Det finns dagar och händelser som alltid etsar sig in i människans minne...."
Joakim Jonsson - 14 dagar sedan
Man kan ju tro att Örträskrosen är sosse
"Ja det är för att den tål att växa upp under kargt klimat. Läs mer här ..."
Lennart Holmlund - 14 dagar sedan
Sommar i P1 med Karin Volo
"När man lyssnar på dagens Sommar -värd Karin Volo , hör man att hon fortf..."
Enn Kokk - 14 dagar sedan
Vi har ingen lägenhet
"Möttes imorse av beskedet att Robert Broberg har lämnat oss. Det är sorgl..."
Joakim Jonsson - 14 dagar sedan
Värden som borde vara värda att försvara för alla liberaler!
"Igår sträckte Stefan Löfven återigen ut handen till mittenpartierna att s..."
Joakim Jonsson - 14 dagar sedan
Cirkulär ekonomi tar Europa ur krisen, räddar vår miljö och gör Sverige världsledande.
"Dagens Anders, Dagens inlägg är ytterligare ett inspel om den cirkulära e..."
Anders Forss - 14 dagar sedan
Rötmånaden är här!
"Rötmånaden är här och som oftast angriper den också det politiska systeme..."
Bengt Silfverstrand - 14 dagar sedan
Vägtunnlar inget för vägar med farligt gods
"Det hände en allvarlig olycka i en vägtunneln i Norge för en tid sedan. V..."
Lennart Holmlund - 14 dagar sedan
Ungdomarna förlorad för socialdemokratin?
"Socialdemokratin har setts som partiet som unga människor ska välja. Dett..."
Roger Jönsson - 14 dagar sedan
Tjänstesamhället är redan här - Därför behöver demokratibegreppet vidgas.
"Dagens Anders, Dagens 2:a inlägg handlar om vikten av att ha en väl funge..."
Anders Forss - 15 dagar sedan
Sommar i P1 med Nisse Hellberg
"Jag är hyggligt bekant med Nisse Hellberg , i vart fall om man avser hans..."
Enn Kokk - 15 dagar sedan
En hållbar värld är möjlig för alla!
"Förra veckan kom EU överens om att fortsätta ge stödlån till Grekland. De..."
Joakim Jonsson - 15 dagar sedan
Blandade upplåtelseformer viktig för att motverka segregation!
"För några år sedan slog Sollentuna nytt svensk rekord i omvandling av hyr..."
Joakim Jonsson - 15 dagar sedan
EU's nya färdriktning leder ut på GIRIGHETENS motorväg.
"Dagens Anders, Dagens inlägg handlar om EU och den GIRIGHET som för närva..."
Anders Forss - 15 dagar sedan
Pensionen kommer att sänkas nästa år
"Läs här där jag förklarar varför Pension Prisbasbelopp Inflation R..."
Lennart Holmlund - 15 dagar sedan
Digital folkrörelse 4.0
"För varje val som går blir internet allt viktigare som informations- och ..."
Roger Jönsson - 15 dagar sedan
Skall jag som social demokrat betala 5000 kr till en nyliberal tidning som hela tiden spyr borgerlig propaganda?
"Efter Nejet till Euron var jag ju imbecill enligt DN. I hela mitt vuxna ..."
Bo Widegren - 16 dagar sedan
Sommar i P1 med Karl-Petter Thorwaldsson
"Jag känner LO -ordföranden Karl-Petter Thorwaldsson , framför allt från h..."
Enn Kokk - 16 dagar sedan
Internet som politisk kanal - något Sd har greppat
"Internetanvändningen är hög i Sverige. 2013 beräknades det att 94,8 proce..."
Roger Jönsson - 16 dagar sedan
Sveket mot pensionärerna
"Myter och fördomar omgärdar i allt högre grad den svenska ankdammsdebatt ..."
Bengt Silfverstrand - 16 dagar sedan
Det tar lång tid innan de som föds i Sverige kom in på arbetsmarknaden
"Det är ganska ofta man får höra att det tar så lång tid för flyktingar oc..."
Lennart Holmlund - 16 dagar sedan
Sommar i P1 med Sanna Lundell
"Jag läser regelbundet Ulf Lundells blogg. Den har sommaruppehåll just nu,..."
Enn Kokk - 17 dagar sedan
Sommar i P1 med Sverker Olofsson
"Självklart känner jag till Sverker Olofsson – från Västerbottens Folkblad..."
Enn Kokk - 17 dagar sedan
En fruktansvärd oro!
"Vi är många som känner oro! Vi är många som känner skräck! Det är fullt f..."
C G Carlsson - 17 dagar sedan
Opera i fårhuset
"Bra med kultur ute på landsbygden med bra artister. Läs här Kultur O..."
Lennart Holmlund - 17 dagar sedan
Folkrörelse 2.0
"Den som tror att val enbart avgörs genom att knacka dörr, synas i tv och ..."
Roger Jönsson - 17 dagar sedan
Melodikrysset nummer 29 2015
"I går var jag i Rinkeby på födelsedagskalas, så jag har kvar att lyssna o..."
Enn Kokk - 17 dagar sedan
En enfaldig slöseriombudsman
"Jag sympatiserar helhjärtat med den gamle socialdemokratiske politikern o..."
Mario Matteoni - 17 dagar sedan
Välfärden värd att strida för!
"Dagens Anders, Dagens inlägg handlar om välfärden och hur den är kopplad ..."
Anders Forss - 17 dagar sedan
Sverker Olofssons sommarprogram och företaget Stiga till för vem
"läs min blogg där jag berömmer Sverker Olofsson men funderar om sådana fö..."
Lennart Holmlund - 18 dagar sedan
Neoliberalism As Water Balloon med Tim McCaskell
"Neoliberalism As Water Balloon from Tim McCaskell on Vimeo : "" Tim M..."
Peter Karlberg - 18 dagar sedan
Smet från olycka – ringde ambulans , många fel i Länstidningens rapport
"Smet från olycka – ringde ambulans – Södertälje – : "" Man ..."
Peter Karlberg - 18 dagar sedan
Polissamarbete knäcker internationella IT bovar
"läs mer genom ett klick på länken Polisen Fbi It Bedrägerier Sver..."
Lennart Holmlund - 18 dagar sedan
Högern på offensiv med dumhet och demagogi
"Med en förenklad och demagogisk syn på hur ekonomin och tillvaron fungera..."
Mario Matteoni - 18 dagar sedan
Offentlig sektor är ett bra fördelningsverktyg i strävan mot ett JÄMLIKT Sverige.
"Dagens Anders, Dagens inlägg handlar om varför offentlig sektor är det ..."
Anders Forss - 18 dagar sedan
Var blev de av, ljuva drömmar?
"Normal 0 21 false false false SV JA X-NONE ..."
Joakim Jonsson - 19 dagar sedan
Klas Östergrens genombrottsroman inte lika lysande som film
"Jag började tidigt läsa Klas Östergren – mina recensioner av några av han..."
Enn Kokk - 19 dagar sedan
Den jämlika vården som försvann
"Principerna om likvärdig vård för alla och att de svårast sjuka ska prior..."
Bengt Silfverstrand - 19 dagar sedan
Sommar i P1 med Leila Lindholm
"Många av dem som plockas ut för att göra radions Sommar är kändisar från ..."
Enn Kokk - 19 dagar sedan
Finanskrisen: Kom inte och säg att vi ingenting visste…
"I DN den 12 juli i år har professorn i nationalekonomi vid Stockholms U..."
Mario Matteoni - 19 dagar sedan
Grekland sa trots allt ja till de krav som ställdes för mera lån
"Man kan ju fråga om det hjälper om de lagar de fattar beslut om när det g..."
Lennart Holmlund - 19 dagar sedan
Mål och måluppfyllelse.
"Dagens Anders, Dagens inlägg handlar även det om kampen för JÄMLIKHET. ..."
Anders Forss - 19 dagar sedan
Kollektiv bloggmakt och kollektivt inflytande
"Statsminister Stefan Löfven tittar ut från podiet över alla journalister ..."
Roger Jönsson - 20 dagar sedan
Sommar i P1 med Herman Geijer
"Herman Geijer har blivit sommarvärd genom en lyssnaromröstning. Hur många..."
Enn Kokk - 20 dagar sedan
Drömmen om ett JÄMLIKT samhälle är levande i mitt liv.
"Dagens Anders, Drömmen om ett JÄMLIKT samhälle är levande i mitt liv - ..."
Anders Forss - 20 dagar sedan
Greklands skatter II
"Greklands regering vill höja bolagsskatten från 26 procent till 28. Dessu..."
Mario Matteoni - 20 dagar sedan
Olagliga bosättningar finns det gott om i Sverige
"Så är det och de är EU migranter som svarar för de flesta men media snara..."
Lennart Holmlund - 20 dagar sedan
Apoteket ABs serie receptfria läkemedel Apofri nu också hos konkurrent
"Det statliga Apoteket AB , fortfarande det ledande företaget i apoteksbra..."
Enn Kokk - 21 dagar sedan
Uppdatering om läget för Grekland
"Det jag skrivit är väl värt att läsa och läs här Grekland Eu Valuta..."
Lennart Holmlund - 21 dagar sedan
Netroots - En progressiv bloggrörelse som sätter agendan
"En gång i tiden, 2000-talets första årtionde, fanns det en rörelse/nätver..."
Roger Jönsson - 21 dagar sedan
Sommar i P1 med Magnus Falkehed
"Magnus Falkeheds " Sommar " är ett av de bästa i den här serien hittills ..."
Enn Kokk - 21 dagar sedan
Jag tror inte Grekerna har insett hur dålig deras lands ekonomi är
"Ta och läs här hur jag tänker Grekland. ekonomi Eu Imf..."
Lennart Holmlund - 21 dagar sedan
Folkomrösta om föräldraförsäkringen!
"Dagens Anders, Dagens inlägg handlar om föräldraförsäkringen och om vil..."
Anders Forss - 21 dagar sedan
Riksbankens penningpolitik har kommit till vägens ände. Dags att tänka nytt!
"För en halvtimme kom de senaste inflationssiffrorna in och de var svagare..."
Joakim Jonsson - 21 dagar sedan
Attentatsmän fick sin träning i Libyen
"läs resten här Libyen Bardomuseet Attentat..."
Lennart Holmlund - 21 dagar sedan
Greklandskrisen ett politiskt spel på hög nivå.
"Dagens Anders, Dagens andra inlägg handlar på nytt om greklandskrisen o..."
Anders Forss - 21 dagar sedan
"I tisdags åkte jag till Danmark och Köpenhamn. Först SWE-buss till Köpenh..."
Katarina Bredberg - 22 dagar sedan
Integrationen flera steg framåt
"Den svenska debatten om flyktingar och invandring har fastnat i ett "blam..."
Roger Jönsson - 22 dagar sedan
Vad definierar en utgift - en kostnad - en investering?
"Dagens Anders, Dagens inlägg handlar om ekonomiska termer och om hur de..."
Anders Forss - 22 dagar sedan
Min skuld, min stora skuld!
"Som barn och ung fick jag lära mig att man helst inte ska låna pengar av ..."
Mario Matteoni - 22 dagar sedan
Sommar i P1 med Nilla Fischer
"Jag är inte ett skvatt intresserad av damfotboll. Men jag är inte det min..."
Enn Kokk - 22 dagar sedan
Rikshem köper i Luleå men bygger också nytt
"Jag tycker man hittat ett bra koncept i Luleå där Rikshem köper gammalt b..."
Lennart Holmlund - 22 dagar sedan
Knark en väg in i döden
"Norge säger att man har slagit nytt världsrekord i död genom en syntetdro..."
Lennart Holmlund - 22 dagar sedan
Några danska noteringar
"Den nya danska minoritetsregeringen – Venstre har bildat enpartiregering ..."
Enn Kokk - 23 dagar sedan
Två norska undersökningar till, en rikspolitisk och en inför kommune- och fylketingsvalet
"De norska tidningarna Nationen och Klassekampen beställer ibland tillsamm..."
Enn Kokk - 23 dagar sedan
Trolöshet mot metoderna - Trofasthet mot värderingarna - Så bygger VI ett JÄMLIKT Sverige.
"Dagens Anders, Dagens andra inlägg är ånyo en återblick och en påminnel..."
Anders Forss - 23 dagar sedan
Sommar i P1 med Johan Rockström
"Dagens sommarvärd, Johan Rockström , är professor i miljövetenskap. Min h..."
Enn Kokk - 23 dagar sedan
Jag tror ingen litar på Grekland
"Vi får snart höra om Grekland får några nya lån. Jag tror det inte för ve..."
Lennart Holmlund - 23 dagar sedan
Sverige håller på att skapa sin egen Greklandskris!
"Korruption, maktfullkomlighet, privatiseringar och nedskärningar. Det är ..."
Björn Andersson - 23 dagar sedan
Vissa skulder är bra skulder.
"Dagens Anders, Dagens inlägg är resultatet av en artikel Johan Ehrenber..."
Anders Forss - 23 dagar sedan
Kampen mot terrorismen måste pågå dagligen
"Läs mera här Is Boko haram Terrorism Usa Irak Syrien..."
Lennart Holmlund - 23 dagar sedan
Den ideologiska drivkraften är det som driver mig.
"Dagens Anders, Dagens inlägg handlar om varför ideologisk övertygelse ä..."
Anders Forss - 24 dagar sedan
Sommar i P1 med Robin Paulsson
"Robin Paulsson berättade i sitt Sommar -program om hur han som mycket ung..."
Enn Kokk - 24 dagar sedan
Melodikrysset nummer 28 2015
"Melodikrysset firade sitt 50-årsjubileum på 30-årsjubilerande Dansbandsve..."
Enn Kokk - 24 dagar sedan
Skickligt manövrerat av den grekiska regeringen
"Det grekiska folket har fått säga sitt i folkomröstningen söndagen den 5 ..."
Mario Matteoni - 24 dagar sedan
Går det att lita på Grekland
"det är den stora frågan nu. Jag är tveksam då det är då mycket som måste ..."
Lennart Holmlund - 24 dagar sedan
Norska mätningar spretar åt lite olika håll
"I Norge genomförs kommunestyre- og fylkestingsvalg den 13 september. De..."
Enn Kokk - 24 dagar sedan
Vem bestämmer om ett land är demokratiskt eller inte?
"Dagens Anders, Dagens inlägg handlar om demokrati som global företeelse..."
Anders Forss - 25 dagar sedan
Estland får ny utrikesminister
"Estlands utrikesminister Keit Pentus-Rosimannus har tvingats eller känt s..."
Enn Kokk - 25 dagar sedan
Sommar i P1 med Marianne Mörck
"Marianne Mörck öppnade sitt Sommar -program i dag mycket starkt, dels gen..."
Enn Kokk - 25 dagar sedan
Se upp för falska profeter....
"Sverigedemokraternas opinionsmässiga framgångar har framkallat närmast eu..."
Bengt Silfverstrand - 25 dagar sedan
Innebär Greklandskrisen lösning att debatten kring DÖ självdör?
"Sent igår kväll levererade Grekland ett nytt reformprogram till Euro-grup..."
Joakim Jonsson - 25 dagar sedan
När världsledande ekonomer talar bör vi politiker lyssna - så även Angela Merkel.
"Dagens Anders, Dagens 2:a inlägg handlar på nytt om skuldkrisen i Grekl..."
Anders Forss - 25 dagar sedan
Fartkamerornas placering behöver nytänk.
"Dagens Anders, Detta är det första av de 2 inlägg jag planerat att göra..."
Anders Forss - 26 dagar sedan
Sommar i P1 med Arash ”Ash” Pournouri
"Det fanns knappast något som intresserade mig i Arash "Ash" Pournouris so..."
Enn Kokk - 26 dagar sedan
Vi kan lära oss mycket av Fredrik Reinfeldts erfarenheter inom bostadsbyggandet
" Häromdagen kom regeringens remissutkast inför investeringsstödet som ..."
Joakim Jonsson - 26 dagar sedan
Läget för EU utsatta medborgare
"Ta och läs denna länk som är en information hur detta hanteras. Det är må..."
Lennart Holmlund - 26 dagar sedan
GIRIGHETEN har inga gränser!
"Dagens Anders, Ibland blir man arg - Andra gånger riktigt ilsken. Detta..."
Anders Forss - 27 dagar sedan
Piketty och fyra andra ledande ekonomer varnar EU för aggressiv sparpolitik gentemot Grekland.
"Fem ledande ekonomer –Thomas Piketty, Jeffrey Sachs, Heiner Flassbeck, Da..."
Bo Widegren - 27 dagar sedan
Sommar i P1 med Hédi Fried
"Hédi Fried föddes 1924 i Sighet i norra Rumänien. Hennes namn skulle kunn..."
Enn Kokk - 27 dagar sedan
Stefan, är vi cyniska kapitalister eller Sociala Demokrater?
"Stefan Löfven, visa nu att Sverige är ett solidariskt land, som inte läng..."
Bo Widegren - 27 dagar sedan
Dags att ta ansvar i det grekiska dramat
"Ingen har väl undgått den senaste veckans diskussioner om Grekland som ty..."
Joakim Jonsson - 27 dagar sedan
Greklands skatter
"En viktig uppgift för den grekiska regeringen är att utveckla sin ålderdo..."
Mario Matteoni - 27 dagar sedan
Sommar i P1 med Kjell Enhager
"Kjell Enhager är föreläsare, ledarskapskonsult och golfinstruktör, och de..."
Enn Kokk - 27 dagar sedan
Har Fi och Gudrun Schyman drabbats av "hjärnsläpp"?
"Dagens Anders, Dagens inlägg handlar om vad jag förmodar måste vara ett..."
Anders Forss - 27 dagar sedan
Vänstern utmanar kapitalismen i Grekland
"I kommentarerna till krisen i Grekland kan man urskilja tydliga höger-vän..."
Mario Matteoni - 27 dagar sedan
Det finns bättre drivmedel för Umeås kollektivtrafik än Biogas
"Tycker att du borde ta dig tid att läsa varför det är så. Läs mera här ..."
Lennart Holmlund - 27 dagar sedan
Det grekiska utpressningsdramat
"Det torde knappast råda några delade meningar om att den djupa ekonomiska..."
Bengt Silfverstrand - 28 dagar sedan
Zlatan vs. Ronaldo
"Nu när både Portugal och Sverige har kvalificerat sig för fotbollsturneri..."
Joakim Jonsson - 28 dagar sedan
Budskapet: Bygga billiga bostäder!
"Idag går regeringens förslag om hur 3,2 miljarder i stimulanser för att b..."
Joakim Jonsson - 28 dagar sedan
"Sakförhållanden kan vara på sin plats vid diskussion om invandring En li..."
C G Carlsson - 28 dagar sedan
Från den 1 januari sänks skatten för pensionärerna
"Det blev många hål i välfärden för de äldre under alliansens tid. Nu börj..."
Lennart Holmlund - 28 dagar sedan
Finansmarknaden har stor del i Greklands kris
"Många av dem som kommenterar greklandskrisen utgår från att den globala f..."
Mario Matteoni - 28 dagar sedan
"Grekland har stått emot avskyvärt översitteri och trakasserier" i EUs försök att manipulera demokratin.
"Och det är nobelpristagaren Paul Krugman som skriver det enligt reportage..."
Bo Widegren - 28 dagar sedan
Varför ljuger Västerbottenskuriren i sina rubriksättning
"Då kan man fråga säg varför ska man läsa tidningar som ljuger i sina rubr..."
Lennart Holmlund - 29 dagar sedan
Grekiska folkomröstningen bevisar KOLLEKTIVETS styrka.
"Dagens Anders, Dagens inlägg handlar om något mycket VIKTIGT - Det hand..."
Anders Forss - 29 dagar sedan
Sommar i P1 med Nina Hemmingsson
"Nina Hemmingsson är född i Uppsala, men det faktum att jag aldrig har möt..."
Enn Kokk - 29 dagar sedan
Nej till finanskapitalets makt
"Majoriteten av väljarna i den grekiska folkomröstningen har röstat mot fi..."
Mario Matteoni - 29 dagar sedan
Invandrare är viktiga för Sverige!
"I den rasistiska och invandrarfientliga våg som breder ut sig över landet..."
C G Carlsson - 29 dagar sedan
Skall du springa Göteborgsvarvet i partitröja oavsett parti?
"En månad nästan har gått sedan denna fråga ställdes. Fortfarande på tok f..."
Katarina Bredberg - 29 dagar sedan
"Sommar, ja. Sommar i Radio P1. Sommar i svenska vädret. Sommar som i seme..."
Katarina Bredberg - 29 dagar sedan
Almedalsfinal med stöd till bostadsklipp
"Så är den till ända Almedalsveckan - året största politiska jippo. En til..."
Bengt Silfverstrand - 29 dagar sedan
Rättvisa löner och full sysselsättning
"Lyssnade på ett seminarie med LO, där avtalssekreterare fanns med och dis..."
Leine Johansson - 29 dagar sedan
Kraftigt publiktapp på Almedalsveckan
"Läs mera här Almedalsveckan Gotland Visby. regering Socialdemokrat..."
Lennart Holmlund - 29 dagar sedan
Last Chorus: Conny Fredriksson
"En av mina gamla arbetskamrater på 68an , Socialdemokratiska partistyrels..."
Enn Kokk - 30 dagar sedan
Många svettades på loppisen på Mörkö – Södertälje –
"Många svettades på loppisen på Mörkö – Södertälje – : "Omkring ..."
Peter Karlberg - 30 dagar sedan
Jan Björklund och folkpartiet misstror människors kreativitet och energi
"Jan Björklund talade idag i Almedalen bland annat om ”curlingsamhället” -..."
Mario Matteoni - 30 dagar sedan
"Socialdemokraten" Jonas Sjöstedt (v) har talat
"Jonas Sjöstedt fokuserade i sitt tal i Almedalen igår starkt på barnfatti..."
Bengt Silfverstrand - 30 dagar sedan
Sommar i P1 med Edvard Moser
"Jag valde själv latinlinjen när jag gick i gymnasiet, så jag är inte särs..."
Enn Kokk - 30 dagar sedan
Almedalsveckan, hela listan
" Normal 0 21 ..."
Joakim Jonsson - 30 dagar sedan
Stora satsningar på äldrevården att vänta
" Normal 0 21 ..."
Joakim Jonsson - 30 dagar sedan
Dags för samhällsbyggande!
" Normal 0 21 ..."
Joakim Jonsson - 30 dagar sedan
Greklandskrisen leder inte till ett nytt Lehman Brother scenario
" Normal 0 21 ..."
Joakim Jonsson - 30 dagar sedan
Behövs folkrörelserna när vi har twitter?
" Normal 0 21 ..."
Joakim Jonsson - 30 dagar sedan
Ryanair ett bolag som inte tecknar kollektivavtal
"Den typen av bolag ska man inte åka med. Läs här Ryanair Kollektivav..."
Lennart Holmlund - 30 dagar sedan
Håll dej till höger Svensson
"Nu är sommartrafiken igång och det är fler på vägarna där jag bor och i r..."
Jan Paimo - 30 dagar sedan
Sommar i P1 med Liza Marklund
"Jag känner inte Liza Marklund personligen, men jag har läst och sett film..."
Enn Kokk - 31 dagar sedan
I framtidens Sverige finns bara VI - I vart fall när jag får inflytande.
"Dagens Anders, Dagens ämne är viktigt och handlar om varför tanken om V..."
Anders Forss - 31 dagar sedan
Politiker och arbetsskadeförsäkringen
"Ett intressant seminarie där LO bjöd in till debatt och diskussion kring ..."
Leine Johansson - 31 dagar sedan
Nej, moderaten Kinberg-Batra är inte smartare än lantisar....
"-Stockholmare är smartare än lantisar , det är ett -"varumärke" som moder..."
Bengt Silfverstrand - 31 dagar sedan
Vänsterpartist helt utan skam
"Riksdagskvinna i V som varit föräldraledig i våren går tillbaka i tjänst ..."
Lennart Holmlund - 31 dagar sedan
Melodikrysset nummer 27 2015
"Den plötsliga värmeböljan har, trots att vi har fläkt, förvandlat vår lan..."
Enn Kokk - 31 dagar sedan
Arvet från de fem
"Sverige är ett fantastiskt land att leva i. Just nu när detta skrivs är i..."
Roger Jönsson - 31 dagar sedan
USA avlyssnar sina vänner
"Det är illa hur USA beter sig. Läs mera här Usa Spioner Avlyssning ..."
Lennart Holmlund - 31 dagar sedan
Ja eller Nej i morgon?
"Den grekiska regeringens desperata kamp mot världens finanssystem har tvi..."
Mario Matteoni - 31 dagar sedan
Grekland, Tyskland och historien
"Historien kan inte utgöra facit för dagens ekonomiska politik. Men man k..."
Mario Matteoni - 31 dagar sedan
Kollektivet ALLTID starkare än individen!
"Dagens Anders, Dagens inlägg belyser varför ett kollektiv ALLTID är sta..."
Anders Forss - 31 dagar sedan
Moderat klavertramp i den bruna myllan....
"Som jag tidigare påpekat kliar det alltmer i den moderata högerpälsen. Fö..."
Bengt Silfverstrand - 32 dagar sedan
Jobb för unga, men till vilket pris?
"Besökte Visitas seminarie kring hur jobben för ungdomar sk kunna öka. Med..."
Leine Johansson - 32 dagar sedan
Sommar i P1 med Saga Becker
"Jag har homosexuella i min vän- och familjekrets och har, även om jag sjä..."
Enn Kokk - 32 dagar sedan
Almedalen skapar möjlighet till utveckling
"Noterar att Vi i Sollentunas chefredaktör mest tyckte Almedalsveckan hand..."
Joakim Jonsson - 32 dagar sedan
Visserligen fortsätter politikerveckan men….
"I kväll talar Anna Kindberg Batra i Alemdalen. Hon säger att hon vill bek..."
Monica Green - 32 dagar sedan
Tala klarspråk M i Skåne!
"I dagens Sydsvenskan går det att läsa en intressant artikel om de skånska..."
Roger Jönsson - 32 dagar sedan
Låt pensionfonderna investera i bostäder
"Då skulle pensionärerna få en bättre avkastning än idag. Läs mera här ..."
Lennart Holmlund - 32 dagar sedan
Återresan mot ett JÄMSTÄLLT Sverige startar NU!
"Dagens Anders, Dagens inlägg är skrivet i filosofiska anda med en stark..."
Anders Forss - 32 dagar sedan
Sommar i P1 med Kenneth Macartney
"Kenneth Macartney är Kanadas ambassadör i Sverige men talar, om än med vi..."
Enn Kokk - 33 dagar sedan
Du har väl inte glömt?
"Det måste påminnas! Det är förskräckligt! Det är fasansfullt! ..."
C G Carlsson - 33 dagar sedan
Stå kvar i hörnan?
"J ust nu befinner vi oss i en lågkonjunktur som har varit sedan 2008. Ojä..."
Roger Jönsson - 33 dagar sedan
Jimmy Åkesson (SD) och det gåtfulla folket....
"-Barn är ett folk och dom bor i ett främmande land, detta land är et..."
Bengt Silfverstrand - 33 dagar sedan
Obehagligt inslag i Almedalen
" Det kändes obehagligt att se hur den fina Almedalen plötsligt belamr..."
Monica Green - 33 dagar sedan
Invandringen är ingen kostnad
"Det är egentligen inte svårt att räkna ut. De allra flesta har någon utbi..."
Lennart Holmlund - 33 dagar sedan
Sommar i P1 med Georgios Karpathakis
"Giorgios Karpathakis hade ett mycket angeläget ämne för sitt Sommar -prog..."
Enn Kokk - 34 dagar sedan
Ebba Busch Thor (KD) är redan en SD-krigare......
"Interna SD-dokument visar att partiet velat värva KD-ledaren Ebba Busch T..."
Bengt Silfverstrand - 34 dagar sedan
Att migrationspolitiken lyfts i Almedalen skapar hopp om en bred parlamentarisk uppgörelse i frågan.
"Dagens Anders, Dagens inlägg tar fasta på att det nu verkar finnas hopp..."
Anders Forss - 34 dagar sedan
Vidga normen
"Kallis hyllar landslagets GULD Almedals minglet i går med Proffice som v..."
Leine Johansson - 34 dagar sedan
Västerbottens Kuriren borde skämmas
"Läs mera här Vk Tidning..."
Lennart Holmlund - 34 dagar sedan
Grattis Vårsta!
"Allmänna Arvsfonden har beviljat medel till Vårsta diakoni i ett treårigt..."
Sig-Britt Ahl - 35 dagar sedan
En t-shirt säger mer är 1000 ord
"Nu pustar vi ut efter UN-womens seminarie Egenmakt att återerövra livet. ..."
Monica Green - 35 dagar sedan
KD hår långre och längre högerut
"Läs mera här Politik Kristdemokratera Högerparti Sap..."
Lennart Holmlund - 35 dagar sedan
Sommar i P1 med Clara Henry
"Clara Henry pratar som en fors i sitt Sommar -program, och min hustru, so..."
Enn Kokk - 35 dagar sedan
Ingen ska skada sig på jobbet
"afa försäkringar som har hand om de kollektiva fösäringarna hade ett semi..."
Leine Johansson - 35 dagar sedan
Stefan Löfvens ofullbordade
"Stefan Löfven höll ett mycket engagerat och bitvis mycket starkt tal i Al..."
Bengt Silfverstrand - 35 dagar sedan
Stefan Löfvens tal fokuserade på utbildning, jobb och skola!
" Som socialdemokrat blev jag stolt över Stefan Löfvens Almedalst..."
Björn Andersson - 35 dagar sedan
Konsten att attrahera till Industri och teknik
"Industrin har svårare att rekrytera personal med rätt kompetens. Sandvike..."
Leine Johansson - 35 dagar sedan
Utmärkt att Löfvens tal i Almedalen följer Socialdemokratisk tradition.
"Dagens Anders, I dagens inlägg gör jag en historisk återblick till Olof..."
Anders Forss - 35 dagar sedan
Svag Venstre-regering ska manövrera Danmark
"Jag har leget lågt med att skriva om följderna av det danska valet. För e..."
Enn Kokk - 35 dagar sedan
Förvirrande om Grekland i TV
"Finska Yle sändning på svenska visar den 29 juni ett reportage från Grekl..."
Mario Matteoni - 36 dagar sedan
Sommar i P1 med Tom Alandh
"Dagens Sommar-pratare var journalisten och filmaren Tom Alandh. Här finns..."
Enn Kokk - 36 dagar sedan
Intensiva dagar i Visby
"Naturligtvis är jag på Gotland denna när politikerveckan i Visby pågår. J..."
Monica Green - 36 dagar sedan
Terror och terror dagliga rubriker
"I stort sett finns det dagliga rubriker om just terrorn och på det sätt d..."
Lennart Holmlund - 36 dagar sedan
Apropå Pride
"Här finns länk till Pride-festivalen i Varberg:"
Katarina Bredberg - 36 dagar sedan
Socialdemokraterna i Almedalen
" Almedalen..."
Katarina Bredberg - 36 dagar sedan
Tänk om - Tänk rätt Morgan Johansson!
"Dagens Anders, I dagens inlägg gör jag något som är både ovanligt och y..."
Anders Forss - 36 dagar sedan
Anpassa arbetsrätten till verkligheten
"LO-TCO Rättsskydd belyser en problematik som genomsyrat Sverige under en ..."
Leine Johansson - 36 dagar sedan
Moderaterna har skapat det "nya utanförskapet" som de idag ger Löfven en känga för!
" Moderaterna gör givetvis utspel för att locka fokusen från Soci..."
Björn Andersson - 36 dagar sedan
Bemanningsbranschen ett måste inom industrin
"Lyssnade på en paneldebatt i Almedalen där IKEM bjudit in bemanningsbrans..."
Leine Johansson - 36 dagar sedan
Trött centerledare i Almedalen
"Inte var det något drag i slöts tal. Jag tycker hon skjuter sig i foten n..."
Lennart Holmlund - 36 dagar sedan
Sänkt skatt för höginkomsttagare ger inte fler jobb!
" De som har en månadslön på mer än 36 900 kronor i månaden ska f..."
Björn Andersson - 37 dagar sedan
Ett axplock av förslag som ger hopp!
"Den politiska rapporteringen har under våren präglas av dåliga nyheter så..."
Joakim Jonsson - 37 dagar sedan
Sommar i P1 med Anna Mannheimer & Peter Apelgren
"Anna Mannheimers pappa Sören Mannheimer träffade jag regelbundet och lärd..."
Enn Kokk - 37 dagar sedan
Annie Lööfs (c) bluff som sprack
"Annie Lööf (c) är först ut av partiledarna när Almedalsveckan drar igång ..."
Bengt Silfverstrand - 37 dagar sedan
Det går inflation i begreppet kränkt !
" Det finns människor idag som vill använda ordet kränkt i samman..."
Björn Andersson - 37 dagar sedan
Alla lån måste betalas även Grekernas
"Det är den stora nyheten i dagarna då alla tröttnat på förhalningstaktike..."
Lennart Holmlund - 37 dagar sedan
Det ökande våldet resultatet av ett ojämlikt samhälle!
"Dagens Anders, Idag ger jag mig på en analys om varför våldet i samhäll..."
Anders Forss - 37 dagar sedan
EU utövar utpressning mot Grekland för att inte använda demokratin
"Skam går på torra land! EU är en omoralisk ockrare! Regeringen Tsipras ..."
Bo Widegren - 38 dagar sedan
Sollentunatidningen satsar på Almedalen
"Imorgon startar Almedalsveckan. Sollentunatidningen är som enda lokaltidn..."
Joakim Jonsson - 38 dagar sedan
Det är sällan jag har fel men i kväll hoppas jag det.
"Det beror på att jag tror Danmark vinner i kväll mot Sverige men hoppet l..."
Lennart Holmlund - 38 dagar sedan
Sommar i P1 med Mona Malm
"Mona Malm är 80 år gammal men har i dag, efter ett helt liv som folkkär s..."
Enn Kokk - 38 dagar sedan
Farväl till vapnen?
"Sverige ska inte få exportera vapen till stater med "grava demokratiska b..."
Bengt Silfverstrand - 38 dagar sedan
Melodikrysset nummer 26 2015
"Jo, jag har lyckats lösa också dagens melodikryss, trots att det innehöll..."
Enn Kokk - 38 dagar sedan
När är du svensk enligt Sverigedemokraterna?
" Året var 1986 och min gymnasieklass var på skolresa i Helsingbor..."
Björn Andersson - 38 dagar sedan
USA borde skämmas och be om offentlig ursäkt
"Att avlyssna franska presidenter är inte riktigt rätt. Läs mera här S..."
Lennart Holmlund - 38 dagar sedan
Balansen mellan offentlig och privat sektor.
"Dagens Anders, Dagens inlägg handlar om varför det är viktigt för Sveri..."
Anders Forss - 38 dagar sedan
Demokratin och kärleken segrar! Homo- och heterosexuella par likställs i Högsta domstolsutslag i USA.
"Likhet inför lagen, som saboteras av konservativa krafter! The first lin..."
Bo Widegren - 38 dagar sedan
Sommar i P1 med Bengt Baron
"Bengt Baron blev först känd som mycket framgångsrik simmare. I sitt Somma..."
Enn Kokk - 39 dagar sedan

Göteborg Norrbotten Västerbotten Jämtland Västernorrland Gävleborg Dalarna Värmland Örebro län Västmanland Uppsala län Sörmland Gotland Kalmar län Blekinge Skåne Kronoberg Jönköpings län Halland Östergötland Stockholms län/Arbetarekommun Skaraborg Bohuslän Norra  lvsborg Södra  lvsborg Starta en egen hemsida och blogg